Identification
Name:Pyrroline-5-carboxylate reductase
Synonyms:
  • P5C reductase
  • P5CR
Gene Name:proC
Enzyme Class:
Biological Properties
General Function:Involved in oxidation-reduction process
Specific Function:L-proline + NAD(P)(+) = 1-pyrroline-5- carboxylate + NAD(P)H
Cellular Location:Cytoplasm
SMPDB Pathways:
KEGG Pathways:
KEGG Reactions:
Thumb+2 Thumb+ThumbThumb+Thumb
Thumb+ThumbThumb+Thumb+Thumb
Thumb+ThumbThumb+Thumb+Thumb
Thumb+ThumbThumb+Thumb+Thumb
Thumb+ThumbThumb+Thumb+Thumb
Thumb+Thumb+ThumbThumb+Thumb+Thumb+Thumb
SMPDB Reactions:
1-Pyrroline-5-carboxylic acid+Thumb+NADPH+Thumb+ThumbThumb+L-Proline+Thumb
1-Pyrroline-5-carboxylic acid + Hydrogen ion + NADPH + L-D-1-Pyrroline-5-carboxylic acid + NADPHNADP + L-Proline + L-Proline
ReactionCard
Complex Reactions:
Thumb+NAD(P)(+)Thumb+NAD(P)H
Metabolites:
ECMDB IDNameView
ECMDB23106(S)-1-pyrroline-5-carboxylateMetaboCard
ECMDB21225Hydrogen ionMetaboCard
ECMDB00725HydroxyprolineMetaboCard
ECMDB01301L-D-1-Pyrroline-5-carboxylic acidMetaboCard
ECMDB00162L-ProlineMetaboCard
ECMDB00902NADMetaboCard
ECMDB01487NADHMetaboCard
ECMDB00217NADPMetaboCard
ECMDB04111NADPHMetaboCard
ECMDB01369Pyrroline hydroxycarboxylic acidMetaboCard
GO Classification:
Function
binding
catalytic activity
oxidoreductase activity
oxidoreductase activity, acting on the CH-NH group of donors
oxidoreductase activity, acting on the CH-NH group of donors, NAD or NADP as acceptor
pyrroline-5-carboxylate reductase activity
Process
cellular amino acid and derivative metabolic process
cellular amino acid metabolic process
cellular metabolic process
glutamine family amino acid metabolic process
metabolic process
oxidation reduction
proline biosynthetic process
proline metabolic process
Gene Properties
Blattner:b0386
Gene OrientationCounterclockwise
Centisome Percentage:8.71
Left Sequence End404059
Right Sequence End404868
Gene Sequence:
>810 bp
ATGACGAAGCATACTCTTGAGCAACTGGCGGCGGATTTACGCCGCGCCGCAGAGCAGGGC
GAAGCGATTGCACCGCTGCGCGATCTGATTGGTATCGATAACGCTGAAGCGGCTTACGCC
ATTCAGCACATAAATGTGCAACATGACGTTGCGCAGGGGCGTCGCGTGGTAGGGCGTAAA
GTGGGCCTGACACATCCGAAAGTGCAACAACAACTGGGCGTTGATCAACCGGATTTTGGG
ACGTTATTTGCCGACATGTGTTATGGCGATAACGAAATCATTCCTTTTTCCCGTGTTCTG
CAACCCCGCATTGAAGCGGAGATCGCACTGGTGTTGAACCGCGATTTGCCCGCAACCGAT
ATCACCTTCGACGAATTGTATAACGCCATTGAATGGGTACTTCCGGCGCTGGAAGTGGTG
GGGAGCCGCATTCGCGACTGGTCGATTCAGTTTGTCGATACCGTGGCAGATAACGCCTCC
TGTGGGGTGTATGTCATCGGCGGTCCGGCGCAACGTCCGGCGGGGTTAGACCTGAAAAAC
TGCGCCATGAAGATGACGCGTAATAACGAAGAGGTTTCTAGCGGGCGCGGCAGCGAATGC
CTGGGACATCCGCTTAATGCGGCCGTCTGGCTGGCACGCAAAATGGCCAGTCTGGGTGAA
CCGCTGCGCACCGGAGATATCATTCTTACCGGGGCATTAGGTCCGATGGTGGCGGTGAAT
GCGGGCGATCGTTTTGAAGCCCATATTGAAGGCATAGGTTCAGTTGCTGCGACATTTTCA
AGCGCAGCCCCAAAAGGAAGTCTGTCATGA
Protein Properties
Pfam Domain Function:
Protein Residues:269
Protein Molecular Weight:28145
Protein Theoretical pI:6
Signaling Regions:
  • None
Transmembrane Regions:
  • None
Protein Sequence:
>Pyrroline-5-carboxylate reductase
MEKKIGFIGCGNMGKAILGGLIASGQVLPGQIWVYTPSPDKVAALHDQFGINAAESAQEV
AQIADIIFAAVKPGIMIKVLSEITSSLNKDSLVVSIAAGVTLDQLARALGHDRKIIRAMP
NTPALVNAGMTSVTPNALVTPEDTADVLNIFRCFGEAEVIAEPMIHPVVGVSGSSPAYVF
MFIEAMADAAVLGGMPRAQAYKFAAQAVMGSAKMVLETGEHPGALKDMVCSPGGTTIEAV
RVLEEKGFRAAVIEAMTKCMEKSEKLSKS
References
External Links:
ResourceLink
Uniprot ID:P0A9L8
Uniprot Name:P5CR_ECOLI
GenBank Gene ID:AP009048
Genebank Protein ID:85674492
Ecogene ID:EG10769
Ecocyc:EG10769
ColiBase:b0386
Kegg Gene:b0386
EchoBASE ID:EB0762
CCDB:P5CR_ECOLI
BacMap:16128371
General Reference:
  • Blattner, F. R., Plunkett, G. 3rd, Bloch, C. A., Perna, N. T., Burland, V., Riley, M., Collado-Vides, J., Glasner, J. D., Rode, C. K., Mayhew, G. F., Gregor, J., Davis, N. W., Kirkpatrick, H. A., Goeden, M. A., Rose, D. J., Mau, B., Shao, Y. (1997). "The complete genome sequence of Escherichia coli K-12." Science 277:1453-1462. Pubmed: 9278503
  • Deutch, A. H., Smith, C. J., Rushlow, K. E., Kretschmer, P. J. (1982). "Escherichia coli delta 1-pyrroline-5-carboxylate reductase: gene sequence, protein overproduction and purification." Nucleic Acids Res 10:7701-7714. Pubmed: 6296787
  • Hayashi, K., Morooka, N., Yamamoto, Y., Fujita, K., Isono, K., Choi, S., Ohtsubo, E., Baba, T., Wanner, B. L., Mori, H., Horiuchi, T. (2006). "Highly accurate genome sequences of Escherichia coli K-12 strains MG1655 and W3110." Mol Syst Biol 2:2006.0007. Pubmed: 16738553