Identification
Name:Glutaminase 2
Synonyms:Not Available
Gene Name:glsA2
Enzyme Class:
Biological Properties
General Function:Involved in glutaminase activity
Specific Function:L-glutamine + H(2)O = L-glutamate + NH(3)
Cellular Location:Cytoplasmic
SMPDB Pathways:
KEGG Pathways:
KEGG Reactions:
Thumb+ThumbThumb+Thumb
Thumb+ThumbThumb+Thumb
Thumb+ThumbThumb+Thumb
Thumb+ThumbThumb+Thumb
SMPDB Reactions:
Thumb+ThumbL-Glutamic acid+Thumb+Thumb
Thumb+ThumbThumb+Thumb
EcoCyc Reactions:
Thumb+ThumbThumb+Thumb
Thumb+ThumbThumb+Thumb
Thumb+ThumbThumb+Thumb
Complex Reactions:
Thumb+ThumbThumb+Thumb
Metabolites:
ECMDB IDNameView
ECMDB00051AmmoniaMetaboCard
ECMDB21186AmmoniumMetaboCard
ECMDB03339D-Glutamic acidMetaboCard
ECMDB03423D-GlutamineMetaboCard
ECMDB00148L-GlutamateMetaboCard
ECMDB00641L-GlutamineMetaboCard
ECMDB00494WaterMetaboCard
GO Classification:
Function
catalytic activity
glutaminase activity
hydrolase activity
hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds
hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds, in linear amides
Process
cellular amino acid and derivative metabolic process
cellular amino acid metabolic process
cellular metabolic process
glutamine family amino acid metabolic process
glutamine metabolic process
metabolic process
Gene Properties
Blattner:b1524
Gene OrientationCounterclockwise
Centisome Percentage:34.71
Left Sequence End1610349
Right Sequence End1611275
Gene Sequence:
>927 bp
ATGACCATTGCACTGGAACTTCAACAGCTTAAAAAAACCTATCCAGGCGGCGTTCAGGCG
CTTCGTGGGATAGATTTGCAGGTCGAAGCGGGTGATTTTTATGCGCTTCTCGGGCCGAAC
GGGGCCGGGAAATCGACCACTATCGGTATTATCAGCTCTCTGGTAAATAAAACCTCCGGG
CGGGTCAGCGTATTTGGTTACGATCTCGAGAAGGATGTCGTGAACGCTAAACGTCAGTTG
GGACTGGTGCCGCAGGAATTTAACTTCAACCCGTTTGAAACCGTGCAGCAAATTGTGGTG
AATCAGGCAGGGTACTACGGCGTGGAGCGCAAAGAAGCGTACATCCGCAGCGAAAAGTAT
CTTAAACAACTCGATCTATGGGGAAAACGCAACGAACGTGCGCGTATGTTATCTGGCGGG
ATGAAGCGCCGTTTAATGATTGCCCGTGCGTTAATGCATGAACCTAAACTACTGATTCTC
GACGAACCGACCGCAGGCGTGGATATTGAACTTCGCCGCTCAATGTGGGGCTTTTTGAAG
GATTTAAACGACAAAGGCACCACCATCATTCTCACCACACACTACCTGGAAGAAGCAGAA
ATGCTGTGCCGCAATATCGGCATTATTCAACACGGTGAGCTGGTGGAAAATACCTCGATG
AAGGCGCTGCTGGCGAAGCTGAAATCGGAAACCTTTATTCTCGATCTCGCACCGAAAAGC
CCGTTACCGAAGCTCGATGGCTATCAGTATCGACTGGTCGATACCGCGACGCTGGAAGTT
GAAGTGCTGCGTGAGCAGGGGATCAACAGCGTATTTACGCAGTTAAGTGAGCAGGGCATT
CAGGTATTAAGTATGCGTAACAAAGCTAACCGTCTGGAAGAGCTGTTTGTTTCACTGGTT
AATGAAAAACAAGGAGATCGCGCATGA
Protein Properties
Pfam Domain Function:
Protein Residues:308
Protein Molecular Weight:33515
Protein Theoretical pI:6
Signaling Regions:
  • None
Transmembrane Regions:
  • None
Protein Sequence:
>Glutaminase 2
MAVAMDNAILENILRQVRPLIGQGKVADYIPALATVDGSRLGIAICTVDGQLFQAGDAQE
RFSIQSISKVLSLVVAMRHYSEEEIWQRVGKDPSGSPFNSLVQLEMEQGIPRNPFINAGA
LVVCDMLQGRLSAPRQRMLEVVRGLSGVSDISYDTVVARSEFEHSARNAAIAWLMKSFGN
FHHDVTTVLQNYFHYCALKMSCVELARTFVFLANQGKAIHIDEPVVTPMQARQINALMAT
SGMYQNAGEFAWRVGLPAKSGVGGGIVAIVPHEMAIAVWSPELDDAGNSLAGIAVLEQLT
KQLGRSVY
References
External Links:
ResourceLink
Uniprot ID:P0A6W0
Uniprot Name:GLSA2_ECOLI
GenBank Gene ID:AP009048
Genebank Protein ID:21238982
Ecogene ID:EG13816
Ecocyc:EG13816
ColiBase:b1524
Kegg Gene:b1524
EchoBASE ID:EB3577
CCDB:GLSA2_ECOLI
BacMap:16129483
General Reference:
  • Aiba, H., Baba, T., Hayashi, K., Inada, T., Isono, K., Itoh, T., Kasai, H., Kashimoto, K., Kimura, S., Kitakawa, M., Kitagawa, M., Makino, K., Miki, T., Mizobuchi, K., Mori, H., Mori, T., Motomura, K., Nakade, S., Nakamura, Y., Nashimoto, H., Nishio, Y., Oshima, T., Saito, N., Sampei, G., Horiuchi, T., et, a. l. .. (1996). "A 570-kb DNA sequence of the Escherichia coli K-12 genome corresponding to the 28.0-40.1 min region on the linkage map." DNA Res 3:363-377. Pubmed: 9097039
  • Blattner, F. R., Plunkett, G. 3rd, Bloch, C. A., Perna, N. T., Burland, V., Riley, M., Collado-Vides, J., Glasner, J. D., Rode, C. K., Mayhew, G. F., Gregor, J., Davis, N. W., Kirkpatrick, H. A., Goeden, M. A., Rose, D. J., Mau, B., Shao, Y. (1997). "The complete genome sequence of Escherichia coli K-12." Science 277:1453-1462. Pubmed: 9278503
  • Hayashi, K., Morooka, N., Yamamoto, Y., Fujita, K., Isono, K., Choi, S., Ohtsubo, E., Baba, T., Wanner, B. L., Mori, H., Horiuchi, T. (2006). "Highly accurate genome sequences of Escherichia coli K-12 strains MG1655 and W3110." Mol Syst Biol 2:2006.0007. Pubmed: 16738553