Identification
Name:D-amino acid dehydrogenase small subunit
Synonyms:Not Available
Gene Name:dadA
Enzyme Class:
Biological Properties
General Function:Involved in D-amino-acid dehydrogenase activity
Specific Function:Oxidative deamination of D-amino acids
Cellular Location:Cell inner membrane; Peripheral membrane protein
SMPDB Pathways:
KEGG Pathways:
KEGG Reactions:
alpha-Amino acid+Thumb+Acceptor2-Oxo acid+Thumb+Reduced acceptor
alpha-Amino acid + Water + Acceptor ↔ 2-Oxo acid + Ammonia + Reduced acceptor
ReactionCard
Thumb+Thumb+AcceptorThumb+Thumb+Reduced acceptor
D-Phenylalanine + Water + Acceptor ↔ Phenylpyruvic acid + Ammonia + Reduced acceptor
ReactionCard
D-Amino acid+Thumb+Acceptor2-Oxo acid+Thumb+Reduced acceptor
D-Amino acid + Water + Acceptor ↔ 2-Oxo acid + Ammonia + Reduced acceptor
ReactionCard
SMPDB Reactions:
Thumb+Thumb+ThumbThumb+Thumb+Thumb
Thumb+Thumb+cytochrome c nitrite reductaseThumb+Thumb+cytochrome c nitrite reductase
Phenylpyruvic acid + Ammonia + cytochrome c nitrite reductase ↔ D-Phenylalanine + Water + cytochrome c nitrite reductase
ReactionCard
Thumb+Thumb+an electron-transfer quinoneThumb+Thumb+electron-transfer quinol
D-Alanine + Water + an electron-transfer quinone → Ammonium + Pyruvic acid + electron-transfer quinol
ReactionCard
Complex Reactions:
Thumb+Thumb+ThumbThumb+Thumb+Thumb
A D-amino acid+Thumb+acceptora 2-oxo acid+Thumb+reduced acceptor
A D-amino acid + Water + acceptor → a 2-oxo acid + Ammonia + reduced acceptor
ReactionCard
Metabolites:
ECMDB IDNameView
ECMDB00051AmmoniaMetaboCard
ECMDB21186AmmoniumMetaboCard
ECMDB01310D-AlanineMetaboCard
ECMDB20144D-PhenylalanineMetaboCard
ECMDB01248FADMetaboCard
ECMDB01197FADH2MetaboCard
ECMDB02434HydroquinoneMetaboCard
ECMDB00205Phenylpyruvic acidMetaboCard
ECMDB00243Pyruvic acidMetaboCard
ECMDB23060QuinoneMetaboCard
ECMDB00494WaterMetaboCard
GO Classification:
Function
catalytic activity
oxidoreductase activity
Gene Properties
Blattner:b1189
Gene OrientationClockwise
Centisome Percentage:26.66
Left Sequence End1236794
Right Sequence End1238092
Gene Sequence:
>1299 bp
ATGACACTCACGCTCAATAGACAACTTCTCACCTCACGCCAGATTCTGGTGGCCTTTAGC
GGCGGGCTTGACTCCACCGTTCTGCTGCATCAGTTGGTGCAGTGGCGGACGGAAAATCCG
GGTGTCGCTCTGCGCGCTATTCATGTGCATCACGGTTTAAGTGCCAATGCCGATGCCTGG
GTTACGCATTGCGAAAACGTCTGCCAACAGTGGCAGGTGCCGCTGGTGGTCGAACGCGTA
CAACTTGCGCAAGAAGGACTGGGCATTGAGGCCCAGGCGCGGCAGGCACGTTATCAGGCA
TTTGCCCGCACCTTGTTGCCCGGTGAAGTGCTGGTCACCGCGCAACATCTCGACGATCAA
TGTGAAACCTTTCTGCTGGCGCTAAAACGCGGCAGTGGCCCTGCCGGGCTTTCGGCTATG
GCGGAAGTCTCGGAGTTTGCCGGAACGCGGCTTATTCGCCCGTTGCTCGCCCGCACGCGG
GGGGAACTGGTGCAGTGGGCGCGTCAGTATGATTTACGCTGGATTGAAGACGAAAGTAAT
CAGGACGACTCATACGATCGTAACTTTCTGCGCCTGCGCGTAGTGCCGTTATTGCAGCAG
CGTTGGCCGCATTTTGCCGAAGCAACGGCCCGCAGCGCCGCACTTTGTGCTGAACAAGAG
AGCCTGCTGGATGAACTGCTGGCAGATGATTTAGCACACTGTCAATCGCCGCAGGGGACG
CTGCAGATTGTGCCAATGCTGGCGATGAGTGATGCCCGCCGCGCGGCGATTATCCGCCGC
TGGCTGGCAGGGCAGAATGCACCGATGCCTTCCCGCGACGCGTTGGTGAGGATCTGGCAG
GAAGTGGCGCTGGCGCGGGAAGATGCCTCACCCTGTTTACGTTTGGGCGCGTTTGAAATC
CGACGCTATCAGTCGCAACTGTGGTGGATTAAATCCGTCACCGGGCAAAGCGAAAACATT
GTGCCGTGGCAGACGTGGCTTCAACCGCTGGAATTACCGGCGGGGCTGGGAAGTGTACAG
CTTAATGCGGGAGGCGATATTCGCCCTCCGCGTGCAGACGAAGCGGTCAGCGTGCGTTTC
AAAGCGCCAGGATTGCTGCATATTGTCGGGCGTAACGGCGGACGTAAGCTAAAGAAAATC
TGGCAAGAGCTGGGCGTGCCGCCGTGGCTACGTGACACCACGCCACTGCTGTTTTATGGC
GAAACGCTGATTGCGGCGGCAGGGGTATTTGTGACGCAAGAAGGTGTGGCTGAAGGTGAG
AATGGCGTAAGTTTTGTCTGGCAGAAAACGCTTAGTTAA
Protein Properties
Pfam Domain Function:
Protein Residues:432
Protein Molecular Weight:47607
Protein Theoretical pI:7
Signaling Regions:
  • None
Transmembrane Regions:
  • None
Protein Sequence:
>D-amino acid dehydrogenase small subunit
MRVVILGSGVVGVASAWYLNQAGHEVTVIDREPGAALETSAANAGQISPGYAAPWAAPGV
PLKAIKWMFQRHAPLAVRLDGTQFQLKWMWQMLRNCDTSHYMENKGRMVRLAEYSRDCLK
ALRAETNIQYEGRQGGTLQLFRTEQQYENATRDIAVLEDAGVPYQLLESSRLAEVEPALA
EVAHKLTGGLQLPNDETGDCQLFTQNLARMAEQAGVKFRFNTPVDQLLCDGEQIYGVKCG
DEVIKADAYVMAFGSYSTAMLKGIVDIPVYPLKGYSLTIPIAQEDGAPVSTILDETYKIA
ITRFDNRIRVGGMAEIVGFNTELLQPRRETLEMVVRDLYPRGGHVEQATFWTGLRPMTPD
GTPVVGRTRFKNLWLNTGHGTLGWTMACGSGQLLSDLLSGRTPAIPYEDLSVARYSRGFT
PSRPGHLHGAHS
References
External Links:
ResourceLink
Uniprot ID:P0A6J5
Uniprot Name:DADA_ECOLI
GenBank Gene ID:AP009048
Genebank Protein ID:4902929
Ecogene ID:EG11407
Ecocyc:EG11407
ColiBase:b1189
Kegg Gene:b1189
EchoBASE ID:EB1379
CCDB:DADA_ECOLI
BacMap:16129152
General Reference:
  • Blattner, F. R., Plunkett, G. 3rd, Bloch, C. A., Perna, N. T., Burland, V., Riley, M., Collado-Vides, J., Glasner, J. D., Rode, C. K., Mayhew, G. F., Gregor, J., Davis, N. W., Kirkpatrick, H. A., Goeden, M. A., Rose, D. J., Mau, B., Shao, Y. (1997). "The complete genome sequence of Escherichia coli K-12." Science 277:1453-1462. Pubmed: 9278503
  • Hayashi, K., Morooka, N., Yamamoto, Y., Fujita, K., Isono, K., Choi, S., Ohtsubo, E., Baba, T., Wanner, B. L., Mori, H., Horiuchi, T. (2006). "Highly accurate genome sequences of Escherichia coli K-12 strains MG1655 and W3110." Mol Syst Biol 2:2006.0007. Pubmed: 16738553
  • Lobocka, M., Hennig, J., Wild, J., Klopotowski, T. (1994). "Organization and expression of the Escherichia coli K-12 dad operon encoding the smaller subunit of D-amino acid dehydrogenase and the catabolic alanine racemase." J Bacteriol 176:1500-1510. Pubmed: 7906689
  • Oshima, T., Aiba, H., Baba, T., Fujita, K., Hayashi, K., Honjo, A., Ikemoto, K., Inada, T., Itoh, T., Kajihara, M., Kanai, K., Kashimoto, K., Kimura, S., Kitagawa, M., Makino, K., Masuda, S., Miki, T., Mizobuchi, K., Mori, H., Motomura, K., Nakamura, Y., Nashimoto, H., Nishio, Y., Saito, N., Horiuchi, T., et, a. l. .. (1996). "A 718-kb DNA sequence of the Escherichia coli K-12 genome corresponding to the 12.7-28.0 min region on the linkage map." DNA Res 3:137-155. Pubmed: 8905232