Identification
Name:NADP-specific glutamate dehydrogenase
Synonyms:
  • NADP-GDH
Gene Name:gdhA
Enzyme Class:
Biological Properties
General Function:Involved in oxidoreductase activity
Specific Function:L-glutamate + H(2)O + NADP(+) = 2-oxoglutarate + NH(3) + NADPH
Cellular Location:Not Available
SMPDB Pathways:
KEGG Pathways:
KEGG Reactions:
Thumb+Thumb+ThumbThumb+Thumb+Thumb+Thumb
Thumb+Thumb+ThumbThumb+Thumb+Thumb+Thumb
SMPDB Reactions:
Thumb+NADPH+Thumb+ThumbThumb+Thumb+L-Glutamic acid+Thumb
Hydrogen ion + NADPH + Ammonia + NADPHWater + NADP + L-Glutamic acid + L-Glutamate
ReactionCard
Thumb+NADPH+Thumb+Thumb+ThumbL-Glutamic acid+Thumb+Thumb+Thumb
EcoCyc Reactions:
Thumb+Thumb+ThumbThumb+Thumb+Thumb
Complex Reactions:
Thumb+Thumb+ThumbThumb+Thumb+Thumb+Thumb
Metabolites:
ECMDB IDNameView
ECMDB02812alpha-KetoglutarateMetaboCard
ECMDB00051AmmoniaMetaboCard
ECMDB21186AmmoniumMetaboCard
ECMDB21225Hydrogen ionMetaboCard
ECMDB00148L-GlutamateMetaboCard
ECMDB00902NADMetaboCard
ECMDB01487NADHMetaboCard
ECMDB00217NADPMetaboCard
ECMDB04111NADPHMetaboCard
ECMDB04123Oxoglutaric acidMetaboCard
ECMDB00494WaterMetaboCard
GO Classification:
Function
binding
catalytic activity
oxidoreductase activity
oxidoreductase activity, acting on the CH-NH2 group of donors
oxidoreductase activity, acting on the CH-NH2 group of donors, NAD or NADP as acceptor
Process
cellular amino acid and derivative metabolic process
cellular amino acid metabolic process
cellular metabolic process
metabolic process
oxidation reduction
Gene Properties
Blattner:b1761
Gene OrientationClockwise
Centisome Percentage:39.67
Left Sequence End1840395
Right Sequence End1841738
Gene Sequence:
>1344 bp
GTGAGCAATCTGTCGCTCGATTTTTCGGATAATACTTTTCAACCTCTGGCCGCGCGTATG
CGGCCAGAAAATTTAGCACAGTATATCGGCCAGCAACATTTGCTGGCTGCGGGGAAGCCG
TTGCCGCGCGCTATCGAAGCCGGGCATTTACATTCTATGATCCTCTGGGGGCCGCCGGGT
ACCGGCAAAACAACTCTCGCTGAAGTGATTGCCCGCTATGCGAACGCTGATGTGGAACGT
ATTTCTGCCGTCACCTCTGGCGTGAAAGAGATTCGCGAGGCGATCGAGCGCGCCCGGCAA
AACCGCAATGCAGGTCGCCGCACTATTCTTTTTGTTGACGAAGTTCACCGTTTCAACAAA
AGCCAGCAGGATGCATTTCTGCCACATATTGAAGACGGCACCATCACTTTTATTGGCGCA
ACCACTGAAAACCCGTCGTTTGAGCTTAATTCGGCACTGCTTTCCCGTGCCCGTGTCTAT
CTGTTGAAATCCCTGAGTACAGAGGATATTGAGCAAGTACTAACTCAGGCGATGGAAGAC
AAAACCCGTGGCTATGGTGGTCAGGATATTGTTCTGCCAGATGAAACACGACGCGCCATT
GCTGAACTGGTGAATGGCGACGCGCGCCGGGCGTTAAATACGCTGGAAATGATGGCGGAT
ATGGCCGAAGTCGATGATAGCGGTAAGCGGGTCCTGAAGCCTGAATTACTGACCGAAATC
GCCGGTGAACGTAGCGCCCGCTTTGATAACAAAGGCGATCGCTTTTACGATCTGATTTCC
GCACTGCATAAGTCGGTACGTGGTAGCGCACCCGATGCGGCGCTGTACTGGTATGCGCGA
ATTATTACCGCTGGTGGCGATCCGTTATATGTCGCGCGTCGCTGTCTGGCGATTGCGTCT
GAAGACGTCGGTAATGCCGATCCACGGGCGATGCAGGTGGCAATTGCGGCCTGGGATTGC
TTTACTCGCGTTGGCCCGGCGGAAGGTGAACGCGCCATTGCTCAGGCGATTGTTTACCTG
GCCTGCGCGCCAAAAAGCAACGCTGTCTACACTGCGTTTAAAGCCGCGCTGGCCGATGCT
CGCGAACGCCCGGATTATGACGTGCCGGTTCATTTGCGTAATGCGCCGACGAAATTAATG
AAGGAAATGGGCTACGGGCAGGAATATCGTTACGCTCATGATGAAGCAAACGCTTATGCT
GCCGGTGAGGTTTACTTCCCGCCGGAAATAGCACAAACACGCTATTATTTCCCGACAAAC
AGGGGCCTTGAAGGCAAGATTGGCGAAAAGCTCGCCTGGCTGGCTGAACAGGATCAAAAT
AGCCCCATAAAACGCTACCGTTAA
Protein Properties
Pfam Domain Function:
Protein Residues:447
Protein Molecular Weight:48581
Protein Theoretical pI:6
Signaling Regions:
  • None
Transmembrane Regions:
  • None
Protein Sequence:
>NADP-specific glutamate dehydrogenase
MDQTYSLESFLNHVQKRDPNQTEFAQAVREVMTTLWPFLEQNPKYRQMSLLERLVEPERV
IQFRVVWVDDRNQIQVNRAWRVQFSSAIGPYKGGMRFHPSVNLSILKFLGFEQTFKNALT
TLPMGGGKGGSDFDPKGKSEGEVMRFCQALMTELYRHLGADTDVPAGDIGVGGREVGFMA
GMMKKLSNNTACVFTGKGLSFGGSLIRPEATGYGLVYFTEAMLKRHGMGFEGMRVSVSGS
GNVAQYAIEKAMEFGARVITASDSSGTVVDESGFTKEKLARLIEIKASRDGRVADYAKEF
GLVYLEGQQPWSLPVDIALPCATQNELDVDAAHQLIANGVKAVAEGANMPTTIEATELFQ
QAGVLFAPGKAANAGGVATSGLEMAQNAARLGWKAEKVDARLHHIMLDIHHACVEHGGEG
EQTNYVQGANIAGFVKVADAMLAQGVI
References
External Links:
ResourceLink
Uniprot ID:P00370
Uniprot Name:DHE4_ECOLI
GenBank Gene ID:AP009048
Genebank Protein ID:4062469
Ecogene ID:EG10372
Ecocyc:EG10372
ColiBase:b1761
Kegg Gene:b1761
EchoBASE ID:EB0367
CCDB:DHE4_ECOLI
BacMap:16129715
General Reference:
  • Aiba, H., Baba, T., Hayashi, K., Inada, T., Isono, K., Itoh, T., Kasai, H., Kashimoto, K., Kimura, S., Kitakawa, M., Kitagawa, M., Makino, K., Miki, T., Mizobuchi, K., Mori, H., Mori, T., Motomura, K., Nakade, S., Nakamura, Y., Nashimoto, H., Nishio, Y., Oshima, T., Saito, N., Sampei, G., Horiuchi, T., et, a. l. .. (1996). "A 570-kb DNA sequence of the Escherichia coli K-12 genome corresponding to the 28.0-40.1 min region on the linkage map." DNA Res 3:363-377. Pubmed: 9097039
  • Blattner, F. R., Plunkett, G. 3rd, Bloch, C. A., Perna, N. T., Burland, V., Riley, M., Collado-Vides, J., Glasner, J. D., Rode, C. K., Mayhew, G. F., Gregor, J., Davis, N. W., Kirkpatrick, H. A., Goeden, M. A., Rose, D. J., Mau, B., Shao, Y. (1997). "The complete genome sequence of Escherichia coli K-12." Science 277:1453-1462. Pubmed: 9278503
  • Hayashi, K., Morooka, N., Yamamoto, Y., Fujita, K., Isono, K., Choi, S., Ohtsubo, E., Baba, T., Wanner, B. L., Mori, H., Horiuchi, T. (2006). "Highly accurate genome sequences of Escherichia coli K-12 strains MG1655 and W3110." Mol Syst Biol 2:2006.0007. Pubmed: 16738553
  • Link, A. J., Robison, K., Church, G. M. (1997). "Comparing the predicted and observed properties of proteins encoded in the genome of Escherichia coli K-12." Electrophoresis 18:1259-1313. Pubmed: 9298646
  • McPherson, M. J., Wootton, J. C. (1983). "Complete nucleotide sequence of the Escherichia coli gdhA gene." Nucleic Acids Res 11:5257-5266. Pubmed: 6308576
  • Valle, F., Becerril, B., Chen, E., Seeburg, P., Heyneker, H., Bolivar, F. (1984). "Complete nucleotide sequence of the glutamate dehydrogenase gene from Escherichia coli K-12." Gene 27:193-199. Pubmed: 6373501