Identification
Name:Autoinducer 2 import system permease protein lsrC
Synonyms:
  • AI-2 import system permease protein lsrC
Gene Name:lsrC
Enzyme Class:Not Available
Biological Properties
General Function:Involved in transporter activity
Specific Function:Part of the ABC transporter complex lsrABCD involved in autoinducer 2 (AI-2) import. Probably responsible for the translocation of the substrate across the membrane
Cellular Location:Cell inner membrane; Multi-pass membrane protein
SMPDB Pathways:
KEGG Pathways:Not Available
Transports:
Transport References:
  • Uniprot Consortium (2012). "Reorganizing the protein space at the Universal Protein Resource (UniProt)." Nucleic Acids Res 40:D71-D75. Pubmed: 22102590
SMPDB Reactions:
(2R,4S)-2-methyl-2,3,3,4-tetrahydroxytetrahydrofuran+Phosphoribosyl-ATP+Thumb+Thumb+Thumb(2R,4S)-2-methyl-2,3,3,4-tetrahydroxytetrahydrofuran+Adenosine diphosphate+Thumb+Pyrophosphate+Thumb
(2R,4S)-2-methyl-2,3,3,4-tetrahydroxytetrahydrofuran + Phosphoribosyl-ATP + Water + (2R,4S)-2-Methyl-2,3,3,4-tetrahydroxytetrahydrofuran + Phosphoribosyl-ATP → (2R,4S)-2-methyl-2,3,3,4-tetrahydroxytetrahydrofuran + Adenosine diphosphate + Hydrogen ion + Pyrophosphate + ADP
ReactionCard
Metabolites:
ECMDB IDNameView
ECMDB21368(2R,4S)-2-Methyl-2,3,3,4-tetrahydroxytetrahydrofuranMetaboCard
ECMDB01341ADPMetaboCard
ECMDB21225Hydrogen ionMetaboCard
ECMDB04138Phosphoribosyl-ATPMetaboCard
ECMDB00494WaterMetaboCard
GO Classification:
Component
cell part
membrane
Function
transporter activity
Process
establishment of localization
transport
Gene Properties
Blattner:Not Available
Gene OrientationNot Available
Centisome Percentage:Not Available
Left Sequence EndNot Available
Right Sequence EndNot Available
Gene Sequence:
>1029 bp
ATGCGCGTACTGCTATTTTTACTTCTTTCCCTTTTCATGTTGCCGGCATTTTCGGCTGAT
AACCTGTTGCGCTGGCATGATGCGCAGCATTTCACGGTGCAAGCCTCTACGCCGCTTAAA
GCCAAACGCGCATGGAAACTGTGCGCGCTTTATCCCAGCCTGAAAGATTCATATTGGTTA
TCGTTGAACTATGGTATGCAGGAGGCTGCTCGCCGCTACGGTGTGGATTTAAAAGTGCTG
GAGGCAGGCGGCTACAGCCAGTTGGCTACCCAGCAAGCACAAATCGACCAGTGTAAACAG
TGGGGCGCAGAGGCCATTTTGCTCGGTAGTAGCACGACCTCATTTCCCGACCTGCAAAAG
CAGGTAGCAAGTCTGCCGGTGATCGAACTGGTAAATGCTATTGATGCTCCCCAGGTGAAA
AGCCGCGTTGGTGTGCCCTGGTTTCAGATGGGCTATCAACCGGGGCGATATCTGGTGCAA
TGGGCGCACGGTAAACCACTGAATGTGCTGTTGATGCCCGGACCCGATAACGCCGGGGGC
AGTAAGGAGATGGTCGAGGGTTTTCGCGCAGCCATTGCCGGAAGCCCGGTGCGTATTGTT
GATATTGCGCTTGGTGATAACGATATTGAAATCCAGCGTAACCTGTTGCAGGAGATGCTG
GAACGCCATCCAGAAATCGACGTCGTTGCCGGAACGGCCATTGCGGCAGAGGCGGCAATG
GGGGAAGGGCGTAACCTGAAAACGCCGCTTACCGTGGTGTCGTTTTATCTTTCACATCAG
GTGTATCGCGGGCTGAAGCGGGGAAGAGTGATTATGGCTGCCAGCGATCAAATGGTCTGG
CAGGGGGAACTGGCGGTTGAGCAGGCCATCAGGCAATTACAGGGGCAATCGGTTTCTGAT
AATGTCAGCCCACCGATTTTAGTTCTGACGCCGAAAAATGCCGACCGTGAACATATTCGC
CGCTCGCTGTCACCAGGGGGATTTCGTCCGGTCTATTTTTATCAGCACACATCAGCGGCT
AAGAAATAA
Protein Properties
Pfam Domain Function:
Protein Residues:342
Protein Molecular Weight:36394
Protein Theoretical pI:10
Signaling Regions:
  • None
Transmembrane Regions:
  • 14-34
  • 39-59
  • 70-90
  • 93-113
  • 115-135
  • 155-175
  • 213-233
  • 252-272
  • 284-304
Protein Sequence:
>Autoinducer 2 import system permease protein lsrC
MLKFIQNNREITALLAVVLLFVLPGFLDRQYLSVQTLTMVYSSAQILILLAMGATLVMLT
RNIDVSVGSITGMCAVLLGMLLNAGYSLPVACVATLLLGLLAGFFNGVLVAWLKIPAIVA
TLGTLGLYRGIMLLWTGGKWIEGLPAELKQLSAPLLLGVSAIGWLTIILVAFMAWLLAKT
AFGRSFYATGDNLQGARQLGVRTEAIRIVAFSLNGCMAALAGIVFASQIGFIPNQTGTGL
EMKAIAACVLGGISLLGGSGAIIGAVLGAWFLTQIDSVLVLLRIPAWWNDFIAGLVLLAV
LVFDGRLRCALERNLRRQKYARFMTPPPSVKPASSGKKREAA
References
External Links:
ResourceLink
Uniprot ID:B1XEA2
Uniprot Name:LSRC_ECODH
GenBank Gene ID:CP000948
Genebank Protein ID:169888488
EchoBASE ID:EB3568
CCDB:LSRC_ECODH
General Reference:
  • Durfee, T., Nelson, R., Baldwin, S., Plunkett, G. 3rd, Burland, V., Mau, B., Petrosino, J. F., Qin, X., Muzny, D. M., Ayele, M., Gibbs, R. A., Csorgo, B., Posfai, G., Weinstock, G. M., Blattner, F. R. (2008). "The complete genome sequence of Escherichia coli DH10B: insights into the biology of a laboratory workhorse." J Bacteriol 190:2597-2606. Pubmed: 18245285