Canmetcon
Identification
Name:Vitamin B12 transporter BtuB
Synonyms:
  • Cobalamin receptor
  • Outer membrane cobalamin translocator
Gene Name:btuB
Enzyme Class:Not Available
Biological Properties
General Function:Involved in receptor activity
Specific Function:Involved in the active translocation of vitamin B12 (cyanocobalamin) across the outer membrane to the periplasmic space. It derives its energy for transport by interacting with the trans-periplasmic membrane protein tonB
Cellular Location:Cell outer membrane; Multi-pass membrane protein
SMPDB Pathways:
  • adenosylcobalamin salvage from cobinamide PW001884
KEGG Pathways:Not Available
Transports:
Transport References:Not Available
Metabolites:
ECMDB IDNameView
GO Classification:
Component
cell part
membrane
Function
molecular transducer activity
receptor activity
signal transducer activity
transporter activity
Process
cobalamin transport
establishment of localization
transport
vitamin transport
Gene Properties
Blattner:Not Available
Gene OrientationNot Available
Centisome Percentage:Not Available
Left Sequence EndNot Available
Right Sequence EndNot Available
Gene Sequence:
>1845 bp
ATGATTAAAAAAGCTTCGCTGCTGACGGCGTGTTCTGTCACAGCCTTTTCCGCTTGGGCA
CAGGATACCAGCCCGGATACTCTCGTCGTTACTGCTAACCGTTTTGAACAGCCGCGCAGC
ACTGTGCTTGCACCAACCACCGTTGTGACGCGTCAGGATATCGACCGCTGGCAGTCGACC
TCGGTTAATGATGTGCTGCGCCGTCTTCCGGGCGTCGATATCACCCAAAACGGCGGTTCA
GGTCAGCTCTCATCTATTTTTATTCGCGGTACAAATGCCAGTCATGTGTTGGTGTTAATT
GATGGCGTACGCCTGAATCTGGCGGGGGGGAGTGGTTCTGCCGACCTTAGCCAGTTCCCT
ATTGCGCTTGTCCAGCGTGTTGAATATATCCGTGGGCCACGCTCCGCCGTTTATGGTTCC
GATGCAATAGGTGGGGTGGTGAATATCATCACGACGCGCGATGAACCCGGAACGGAAATT
TCAGCAGGGTGGGGAAGCAATAGTTATCAAAACTATGATGTCTCTACACAGCAACAACTG
GGGGATAAGACACGAGTAACGTTGTTGGGCGATTATGCCCATACTCATGGTTATGATGTT
GTTGCCTATGGTAATACCGGAACGCAAGCGCAGCCAGATAACGATGGTTTTTTAAGTAAA
ACGCTTTATGGCGCGCTGGAGCATAACTTTACTGATGCCTGGAGCGGCTTTGTGCGCGGC
TATGGCTATGATAACCGTACCAATTATGACGCGTATTATTCTCCGGGTTCACCATTGGTC
GATACCCGTAAACTCTATAGTCAAAGTTGGGACGCCGGGCTGCGATATAACGGCGAACTG
ATTAAATCACAACTCATTACCAGCTATAGCCATAGCAAAGATTACAACTACGATCCCCAT
TATGGTCGTTATGATTCGTCGGCGACGCTCGATGAGATGAAGCAATACACCGTCCAGTGG
GCAAACAACATCATCATTGGCCACGGTAATGTTGGTGCGGGTGTTGACTGGCAGAAGCAG
AGCACGGCACCGGGCACAGCTTATGTTAAGGATGGATATGATCAACGTAATACCGGCATC
TATCTGACCGGGCTGCAACAAGTCGGCGATTTTACCTTTGAAGGCGCAGCACGCAGCGAC
GATAACTCACAGTTTGGTCGTCATGGAACCTGGCAAACCAGCGCCGGTTGGGAATTCATC
GAAGGTTATCGCTTCATTGCTTCCTACGGGACATCTTATAAGGCACCAAATCTGGGGCAA
CTGTATGGCTTCTACGGAAATCCGAATCTGGACCCGGAGAAAAGCAAACAGTGGGAAGGC
GCGTTTGAAGGCTTAACCGCTGGGGTGAACTGGCGTATTTCCGGATATCGTAACGATGTC
AGTGACTTGATCGATTATGATGATCACACCCTGAAATATTACAACGAAGGGAAAGCGCGG
ATTAAGGGCGTCGAGGCGACCGCCAATTTTGATACCGGACCACTGACGCATACTGTGAGT
TATGATTATGTCGATGCGCGCAATGCAATTACCGACACGCCGTTGTTACGCCGTGCTAAA
CAGCAGGTGAAATACCAGCTCGACTGGCAGTTGTATGACTTCGACTGGGGTATTACTTAT
CAGTATTTAGGCACTCGCTATGATAAGGATTACTCATCTTATCCTTATCAAACCGTTAAA
ATGGGCGGTGTGAGCTTGTGGGATCTTGCGGTTGCGTATCCGGTCACCTCTCACCTGACA
GTTCGTGGTAAAATAGCCAACCTGTTCGACAAAGATTATGAGACAGTCTATGGCTACCAA
ACTGCAGGACGGGAATACACCTTGTCTGGCAGCTACACCTTCTGA
Protein Properties
Pfam Domain Function:
Protein Residues:614
Protein Molecular Weight:68357
Protein Theoretical pI:5
PDB File:1UJW
Signaling Regions:
  • 1-20
Transmembrane Regions:
  • 158-165
  • 169-178
  • 184-195
  • 217-227
  • 232-248
  • 263-277
  • 279-296
  • 309-325
  • 328-337
  • 353-369
  • 371-381
  • 385-400
  • 403-417
  • 434-443
  • 449-458
  • 473-490
  • 494-509
  • 517-529
  • 535-550
  • 558-572
  • 585-596
  • 602-614
Protein Sequence:
>Vitamin B12 transporter BtuB
MIKKASLLTACSVTAFSAWAQDTSPDTLVVTANRFEQPRSTVLAPTTVVTRQDIDRWQST
SVNDVLRRLPGVDITQNGGSGQLSSIFIRGTNASHVLVLIDGVRLNLAGGSGSADLSQFP
IALVQRVEYIRGPRSAVYGSDAIGGVVNIITTRDEPGTEISAGWGSNSYQNYDVSTQQQL
GDKTRVTLLGDYAHTHGYDVVAYGNTGTQAQPDNDGFLSKTLYGALEHNFTDAWSGFVRG
YGYDNRTNYDAYYSPGSPLVDTRKLYSQSWDAGLRYNGELIKSQLITSYSHSKDYNYDPH
YGRYDSSATLDEMKQYTVQWANNIIIGHGNVGAGVDWQKQSTAPGTAYVKDGYDQRNTGI
YLTGLQQVGDFTFEGAARSDDNSQFGRHGTWQTSAGWEFIEGYRFIASYGTSYKAPNLGQ
LYGFYGNPNLDPEKSKQWEGAFEGLTAGVNWRISGYRNDVSDLIDYDDHTLKYYNEGKAR
IKGVEATANFDTGPLTHTVSYDYVDARNAITDTPLLRRAKQQVKYQLDWQLYDFDWGITY
QYLGTRYDKDYSSYPYQTVKMGGVSLWDLAVAYPVTSHLTVRGKIANLFDKDYETVYGYQ
TAGREYTLSGSYTF
References
External Links:
ResourceLink
Uniprot ID:Q8X714
Uniprot Name:BTUB_ECO57
GenBank Gene ID:AE005174
Genebank Protein ID:12518893
PDB ID:1UJW
EchoBASE ID:EB0124
CCDB:BTUB_ECO57
General Reference:
  • Hayashi, T., Makino, K., Ohnishi, M., Kurokawa, K., Ishii, K., Yokoyama, K., Han, C. G., Ohtsubo, E., Nakayama, K., Murata, T., Tanaka, M., Tobe, T., Iida, T., Takami, H., Honda, T., Sasakawa, C., Ogasawara, N., Yasunaga, T., Kuhara, S., Shiba, T., Hattori, M., Shinagawa, H. (2001). "Complete genome sequence of enterohemorrhagic Escherichia coli O157:H7 and genomic comparison with a laboratory strain K-12." DNA Res 8:11-22. Pubmed: 11258796
  • Perna, N. T., Plunkett, G. 3rd, Burland, V., Mau, B., Glasner, J. D., Rose, D. J., Mayhew, G. F., Evans, P. S., Gregor, J., Kirkpatrick, H. A., Posfai, G., Hackett, J., Klink, S., Boutin, A., Shao, Y., Miller, L., Grotbeck, E. J., Davis, N. W., Lim, A., Dimalanta, E. T., Potamousis, K. D., Apodaca, J., Anantharaman, T. S., Lin, J., Yen, G., Schwartz, D. C., Welch, R. A., Blattner, F. R. (2001). "Genome sequence of enterohaemorrhagic Escherichia coli O157:H7." Nature 409:529-533. Pubmed: 11206551