| Identification |
|---|
| Name: | Carbon storage regulator |
|---|
| Synonyms: | Not Available |
|---|
| Gene Name: | csrA |
|---|
| Enzyme Class: | Not Available |
|---|
| Biological Properties |
|---|
| General Function: | negative regulation of translational initiation |
|---|
| Specific Function: | Binds to mRNA to regulate post-transcriptional activity. Affects glycogen biosynthesis, gluconeogenesis, cell size and surface properties. Regulates glycogen synthesis under both aerobic and anaerobic conditions. Seems to accelerate the degradation of glg gene transcripts, potentially through selective RNA binding. Acts to inhibit interaction between the LetD protein and the A subunit of DNA gyrase. Also required for motility and flagellum biosynthesis through the post-transcriptional activation of flhDC expression. This involves binding to and stabilization of the flhDC message by CsrA. Binds to and reduces levels of probable diguanylate cyclases ycdT and ydeH. |
|---|
| Cellular Location: | Not Available |
|---|
| SMPDB Pathways: | Not Available |
|---|
| KEGG Pathways: | |
|---|
| Metabolites: | |
|---|
| GO Classification: | | Function |
|---|
| mRNA 5'-UTR binding | | mRNA catabolic process | | negative regulation of glycogen biosynthetic process | | negative regulation of translational initiation |
|
|---|
| Gene Properties |
|---|
| Blattner: | Not Available |
|---|
| Gene Orientation | Not Available |
|---|
| Centisome Percentage: | Not Available |
|---|
| Left Sequence End | Not Available |
|---|
| Right Sequence End | Not Available |
|---|
| Gene Sequence: | >186
atgctgattctgactcgtcgagttggtgagaccctcatgattggggatgaggtcaccgtg
acagttttaggggtaaagggcaaccaggtacgtattggcgtaaatgccccgaaggaagtt
tctgttcaccgtgaagagatctaccagcgtatccaggctgaaaaatcccagcagtccagt
tactaa |
|---|
| Protein Properties |
|---|
| Pfam Domain Function: | Not Available |
|---|
| Protein Residues: | 61 |
|---|
| Protein Molecular Weight: | 6855 |
|---|
| Protein Theoretical pI: | Not Available |
|---|
| PDB File: | 1Y00 |
| Signaling Regions: | Not Available |
|---|
| Transmembrane Regions: | Not Available |
|---|
| Protein Sequence: | >Carbon storage regulator
MLILTRRVGETLMIGDEVTVTVLGVKGNQVRIGVNAPKEVSVHREEIYQRIQAEKSQQSS
Y |
|---|
| References |
|---|
| External Links: | |
|---|
| General Reference: | Not Available |
|---|
