Identification
Name:tRNA-specific adenosine deaminase
Synonyms:Not Available
Gene Name:tadA
Enzyme Class:
Biological Properties
General Function:Energy production and conversion
Specific Function:Deaminates adenosine-34 to inosine in tRNA-Arg2. Mutation in this protein makes E.coli resistant to the toxic proteins encoded by the gef gene family. Essential for cell viability
Cellular Location:Cytoplasmic
SMPDB Pathways:Not Available
KEGG Pathways:Not Available
KEGG Reactions:
Thumb+ThumbThumb+Thumb
ThumbThumb
EcoCyc Reactions:
Thumb+ThumbThumb+Thumb
Complex Reactions:
Thumb+ThumbThumb+Thumb
Metabolites:
ECMDB IDNameView
ECMDB00050AdenosineMetaboCard
ECMDB00051AmmoniaMetaboCard
ECMDB00195InosineMetaboCard
ECMDB00494WaterMetaboCard
GO Classification:
Function
binding
catalytic activity
cation binding
hydrolase activity
ion binding
metal ion binding
transition metal ion binding
zinc ion binding
Gene Properties
Blattner:Not Available
Gene OrientationNot Available
Centisome Percentage:Not Available
Left Sequence EndNot Available
Right Sequence EndNot Available
Gene Sequence:
>504 bp
ATGCCGGGCAACAGCCCGCATTATGGGCGTTGGCCTCAACACGATTTTCCGCCATTTAAA
AAACTCAGGCCGCAGTCGGTAACCTCGCGCATACAGCCGGGCAGTGACGTCATCGTCTGC
GCGGAAATGGACGAACAGTGGGGATACGTCGGGGCTAAATCGCGCCAGCGCTGGCTGTTT
TACGCGTATGACAGGCTCCGGAAGACGGTTGTTGCGCACGTATTCGGTGAACGCACTATG
GCGACGCTGGGGCGTCTTATGAGCCTGCTGTCACCCTTTGACGTGGTGATATGGATGACG
GATGGCTGGCCGCTGTATGAATCCCGCCTGAAGGGAAAGCTGCACGTAATCAGCAAGCGA
TATACGCAGCGAATTGAGCGGTATAACCTGAATCTGAGGCAGCACCTGGCACGGCTGGGA
CGGAAGTCGCTGTCGTTCTCAAAATCGGTGGAGCTGCATGACAAAGTCATCGGGCATTAT
CTGAACATAAAACACTATCAATAA
Protein Properties
Pfam Domain Function:
Protein Residues:167
Protein Molecular Weight:18717
Protein Theoretical pI:8
Signaling Regions:
  • None
Transmembrane Regions:
  • None
Protein Sequence:
>tRNA-specific adenosine deaminase
MSEVEFSHEYWMRHALTLAKRAWDEREVPVGAVLVHNNRVIGEGWNRPIGRHDPTAHAEI
MALRQGGLVMQNYRLIDATLYVTLEPCVMCAGAMIHSRIGRVVFGARDAKTGAAGSLMDV
LHHPGMNHRVEITEGILADECAALLSDFFRMRRQEIKAQKKAQSSTD
References
External Links:
ResourceLink
Uniprot ID:P68398
Uniprot Name:TADA_ECOLI
GenBank Gene ID:U00096
Genebank Protein ID:1787223
CCDB:TADA_ECOLI
General Reference:
  • Blattner, F. R., Plunkett, G. 3rd, Bloch, C. A., Perna, N. T., Burland, V., Riley, M., Collado-Vides, J., Glasner, J. D., Rode, C. K., Mayhew, G. F., Gregor, J., Davis, N. W., Kirkpatrick, H. A., Goeden, M. A., Rose, D. J., Mau, B., Shao, Y. (1997). "The complete genome sequence of Escherichia coli K-12." Science 277:1453-1462. Pubmed: 9278503
  • Hayashi, K., Morooka, N., Yamamoto, Y., Fujita, K., Isono, K., Choi, S., Ohtsubo, E., Baba, T., Wanner, B. L., Mori, H., Horiuchi, T. (2006). "Highly accurate genome sequences of Escherichia coli K-12 strains MG1655 and W3110." Mol Syst Biol 2:2006.0007. Pubmed: 16738553
  • Poulsen, L. K., Larsen, N. W., Molin, S., Andersson, P. (1992). "Analysis of an Escherichia coli mutant strain resistant to the cell-killing function encoded by the gef gene family." Mol Microbiol 6:895-905. Pubmed: 1602968
  • Wolf, J., Gerber, A. P., Keller, W. (2002). "tadA, an essential tRNA-specific adenosine deaminase from Escherichia coli." EMBO J 21:3841-3851. Pubmed: 12110595