Identification
Name:Putrescine aminotransferase
Synonyms:
  • Putrescine--2-oxoglutaric acid transaminase
  • PAT
  • PATase
Gene Name:patA
Enzyme Class:
Biological Properties
General Function:Involved in transaminase activity
Specific Function:Catalyzes the aminotransferase reaction from putrescine to 2-oxoglutarate, leading to glutamate and 4-aminobutanal, which spontaneously cyclizes to form 1-pyrroline. Is also able to transaminate cadaverine and, in lower extent, spermidine, but not ornithine. Alpha-ketobutyrate and pyruvate can also act as amino acceptors, although much less efficiently
Cellular Location:Not Available
SMPDB Pathways:
KEGG Pathways:
  • Arginine and proline metabolism ec00330
KEGG Reactions:
Thumb+ThumbThumb+Thumb
Thumb+ThumbThumb+Thumb
Thumb+Thumb+ThumbThumb+Thumb+Thumb
SMPDB Reactions:
Thumb+ThumbL-Glutamic acid+Thumb+Thumb
Thumb+ThumbL-Glutamic acid+Thumb+Thumb+Thumb
EcoCyc Reactions:
an aliphatic α,ω-diamine+Thumban aliphatic ω-aminoaldehyde+Thumb
an aliphatic α,ω-diamine + Oxoglutaric acid ↔ an aliphatic ω-aminoaldehyde + L-Glutamate
ReactionCard
Thumb+ThumbThumb+Thumb
Complex Reactions:
Thumb+ThumbThumb+Thumb+Thumb
Metabolites:
ECMDB IDNameView
ECMDB200301-PyrrolineMetaboCard
ECMDB010804-AminobutyraldehydeMetaboCard
ECMDB02812alpha-KetoglutarateMetaboCard
ECMDB20274EthylenediamineMetaboCard
ECMDB00148L-GlutamateMetaboCard
ECMDB04123Oxoglutaric acidMetaboCard
ECMDB01414PutrescineMetaboCard
ECMDB00494WaterMetaboCard
GO Classification:
Function
binding
butane-1,4-diamine:2-oxoglutarate aminotransferase activity
catalytic activity
cofactor binding
pyridoxal phosphate binding
transaminase activity
transferase activity
transferase activity, transferring nitrogenous groups
Process
cellular amino acid and derivative metabolic process
cellular amino acid derivative metabolic process
cellular biogenic amine metabolic process
cellular metabolic process
metabolic process
polyamine catabolic process
polyamine metabolic process
putrescine catabolic process
Gene Properties
Blattner:b3073
Gene OrientationClockwise
Centisome Percentage:69.35
Left Sequence End3217516
Right Sequence End3218895
Gene Sequence:
>1380 bp
ATGCCGCCTGGCGTCGCGGTTTGTTTTTCATCTCTCTTCATCAGGCTTGTCTGCATGGCA
TTCCTCACTTCATCTGATAAAGCACTCTGGCATCTCGCCTTACCCATGATTTTCTCCAAT
ATCACCGTTCCGTTGCTGGGACTGGTCGATACGGCGGTAATTGGTCATCTTGATAGCCCG
GTTTATTTGGGCGGCGTGGCGGTTGGTGCAACGGCGACCAGCTTTCTCTTTATGCTGTTG
CTGTTTTTACGCATGAGCACCACCGGGCTGACTGCGCAGGCTTATGGTGCCAAAAATCCT
CAGGCATTAGCCCGTACGCTGGTGCAACCGTTGCTGTTGGCGTTGGGGGCTGGGGCGTTA
ATTGCGCTGCTGCGTACGCCGATTATCGATCTGGCGCTGCATATTGTTGGCGGTAGTGAG
GCAGTCCTGGAACAGGCGCGGCGCTTTCTTGAAATCCGCTGGTTAAGCGCACCGGCGTCG
CTGGCGAATCTGGTATTACTCGGTTGGTTACTCGGCGTGCAATATGCCCGTGCGCCAGTA
ATTTTGTTAGTGGTCGGCAATATCCTCAACATTGTGCTGGATGTCTGGCTGGTGATGGGG
CTGCATATGAACGTGCAGGGCGCGGCGCTGGCGACGGTTATTGCGGAATATGCAACATTG
CTGATTGGTCTGCTAATGGTGCGTAAAATCCTCAAACTACGCGGAATTTCCGGCGAAATG
CTGAAAACTGCCTGGCGAGGAAACTTCCGTCGCTTGCTGGCGCTTAACCGCGATATCATG
CTGCGTTCGCTGTTGTTGCAACTCTGTTTCGGCGCGATCACCGTACTTGGCGCGCGACTG
GGGAGTGACATTATCGCTGTTAACGCGGTTCTGATGACGCTACTCACCTTTACCGCCTAT
GCGCTGGATGGTTTTGCCTACGCGGTTGAAGCGCACTCCGGTCAGGCATACGGTGCGCGC
GACGGTAGCCAGTTGCTGGATGTCTGGCGGGCAGCGTGCCGCCAGTCGGGGATCGTAGCG
TTACTGTTTTCGGTGGTTTATTTGCTGGCTGGGGAACACATCATTGCGTTACTGACGTCG
TTAACCCAGATTCAGCAGCTGGCTGACCGCTATCTTATCTGGCAGGTGATTTTGCCGGTG
GTTGGCGTCTGGTGTTATCTGCTGGACGGCATGTTTATAGGCGCAACGCGTGCCACCGAA
ATGCGTAACAGTATGGCGGTGGCCGCCGCAGGTTTTGCGCTGACGCTCCTTACGCTGCCG
TGGCTGGGTAATCATGCTTTGTGGCTGGCATTAACCGTCTTTCTGGCGTTGCGCGGGCTT
TCTCTGGCGGCTATCTGGCGGCGTCACTGGCGCAATGGTACCTGGTTTGCCGCAACGTGA
Protein Properties
Pfam Domain Function:
Protein Residues:459
Protein Molecular Weight:49661
Protein Theoretical pI:6
Signaling Regions:
  • None
Transmembrane Regions:
  • None
Protein Sequence:
>Putrescine aminotransferase
MNRLPSSASALACSAHALNLIEKRTLDHEEMKALNREVIEYFKEHVNPGFLEYRKSVTAG
GDYGAVEWQAGSLNTLVDTQGQEFIDCLGGFGIFNVGHRNPVVVSAVQNQLAKQPLHSQE
LLDPLRAMLAKTLAALTPGKLKYSFFCNSGTESVEAALKLAKAYQSPRGKFTFIATSGAF
HGKSLGALSATAKSTFRKPFMPLLPGFRHVPFGNIEAMRTALNECKKTGDDVAAVILEPI
QGEGGVILPPPGYLTAVRKLCDEFGALMILDEVQTGMGRTGKMFACEHENVQPDILCLAK
ALGGGVMPIGATIATEEVFSVLFDNPFLHTTTFGGNPLACAAALATINVLLEQNLPAQAE
QKGDMLLDGFRQLAREYPDLVQEARGKGMLMAIEFVDNEIGYNFASEMFRQRVLVAGTLN
NAKTIRIEPPLTLTIEQCELVIKAARKALAAMRVSVEEA
References
External Links:
ResourceLink
Uniprot ID:P42588
Uniprot Name:PAT_ECOLI
GenBank Gene ID:AP009048
Genebank Protein ID:85676796
Ecogene ID:EG12718
Ecocyc:EG12718
ColiBase:b3073
Kegg Gene:b3073
EchoBASE ID:EB2577
CCDB:PAT_ECOLI
BacMap:145698310
General Reference:
  • Blattner, F. R., Plunkett, G. 3rd, Bloch, C. A., Perna, N. T., Burland, V., Riley, M., Collado-Vides, J., Glasner, J. D., Rode, C. K., Mayhew, G. F., Gregor, J., Davis, N. W., Kirkpatrick, H. A., Goeden, M. A., Rose, D. J., Mau, B., Shao, Y. (1997). "The complete genome sequence of Escherichia coli K-12." Science 277:1453-1462. Pubmed: 9278503
  • Hayashi, K., Morooka, N., Yamamoto, Y., Fujita, K., Isono, K., Choi, S., Ohtsubo, E., Baba, T., Wanner, B. L., Mori, H., Horiuchi, T. (2006). "Highly accurate genome sequences of Escherichia coli K-12 strains MG1655 and W3110." Mol Syst Biol 2:2006.0007. Pubmed: 16738553
  • Samsonova, N. N., Smirnov, S. V., Altman, I. B., Ptitsyn, L. R. (2003). "Molecular cloning and characterization of Escherichia coli K12 ygjG gene." BMC Microbiol 3:2. Pubmed: 12617754