Identification
Name:Chitooligosaccharide deacetylase ChbG
Synonyms:Not Available
Gene Name:chbG
Enzyme Class:
Biological Properties
General Function:polysaccharide catabolic process
Specific Function:ChbG is essential for growth on the acetylated chitooligosaccharides chitobiose and chitotriose but is dispensable for growth on cellobiose and chitosan dimer, the deacetylated form of chitobiose. Deacetylation of chitobiose-6-P and chitotriose-6-P is necessary for both the activation of the chb promoter by the regulatory protein ChbR and the hydrolysis of phosphorylated beta-glucosides by the phospho-beta-glucosidase ChbF. Catalyzes the removal of only one acetyl group from chitobiose-6-P to yield monoacetylchitobiose-6-P, the inducer of ChbR and the substrate of ChbF. It can also use chitobiose and chitotriose as substrates.
Cellular Location:Not Available
SMPDB Pathways:
KEGG Pathways:Not Available
SMPDB Reactions:
Thumb+ThumbN'-monoacetylchitobiose-6'-phosphate+Thumb
Diacetylchitobiose-6-phosphate + Water → N'-monoacetylchitobiose-6'-phosphate + Acetic acid
ReactionCard
Metabolites:
ECMDB IDNameView
ECMDB00042Acetic acidMetaboCard
ECMDB20547Diacetylchitobiose-6-phosphateMetaboCard
ECMDB00494WaterMetaboCard
GO Classification:
Function
chitin catabolic process
chitin disaccharide deacetylase activity
cytoplasm
deacetylase activity
diacetylchitobiose catabolic process
metal ion binding
polysaccharide catabolic process
Gene Properties
Blattner:Not Available
Gene OrientationNot Available
Centisome Percentage:Not Available
Left Sequence EndNot Available
Right Sequence EndNot Available
Gene Sequence:
>750
atggaacgcttactgattgttaatgccgatgattttggcttaagcaaaggtcagaactac
ggcattatcgaggcctgtcgcaatgggattgtcacgtcgacgacggcgctggtgaatggg
caggctattgaccatgcggtgcagttgagtcgtgatgaaccgagtctggccatagggatg
cactttgtccttactatgggtaagccactgacagctatgccggggttaacccgcgatggt
gtgctgggaaaatggatctggcagttggcagaagaagatgctttaccgctggaagaaatt
actcaggagcttgtcagtcagtatttgcgtttcattgagctatttggacgcaaacctacg
catcttgatagccatcatcatgtgcatatgttcccgcagattttcccgattgttgccagg
tttgcggcagagcagggcattgcgttgcgggcggatcgtcagatggcgtttgatttgccg
gtcaacctgcgcactacccagggattcagcagtgcattctacggtgaagagatcagtgag
tcgctgttcctgcaagtgctggatgacgcaggccatcggggtgatcgttcgctggaggtg
atgtgtcatccggcgtttatcgataatactatccgtcagagtgcttactgtttcccacgc
ttaacggagctggatgtgttgacatcagcgtcgttgaaaggtgctatcgctcagcgtggt
tatcggttggggagttatcgggatgtgtaa
Protein Properties
Pfam Domain Function:Not Available
Protein Residues:249
Protein Molecular Weight:27773
Protein Theoretical pI:Not Available
Signaling Regions:Not Available
Transmembrane Regions:Not Available
Protein Sequence:
>Chitooligosaccharide deacetylase ChbG
MERLLIVNADDFGLSKGQNYGIIEACRNGIVTSTTALVNGQAIDHAVQLSRDEPSLAIGM
HFVLTMGKPLTAMPGLTRDGVLGKWIWQLAEEDALPLEEITQELVSQYLRFIELFGRKPT
HLDSHHHVHMFPQIFPIVARFAAEQGIALRADRQMAFDLPVNLRTTQGFSSAFYGEEISE
SLFLQVLDDAGHRGDRSLEVMCHPAFIDNTIRQSAYCFPRLTELDVLTSASLKGAIAQRG
YRLGSYRDV
References
External Links:
ResourceLink
Uniprot ID:P37794
Uniprot Name:CHBG_ECOLI
CCDB:CHBG_ECOLI
General Reference:Not Available