Canmetcon
Identification
Name:Ethanolamine ammonia-lyase light chain
Synonyms:
  • Ethanolamine ammonia-lyase small subunit
Gene Name:eutC
Enzyme Class:
Biological Properties
General Function:Involved in ethanolamine ammonia-lyase activity
Specific Function:Ethanolamine = acetaldehyde + NH(3)
Cellular Location:Not Available
SMPDB Pathways:
KEGG Pathways:
KEGG Reactions:
ThumbThumb+Thumb
SMPDB Reactions:
ThumbThumb+Thumb
EcoCyc Reactions:
ThumbThumb+Thumb
Complex Reactions:
ThumbThumb+Thumb
ThumbThumb+Thumb
Metabolites:
ECMDB IDNameView
ECMDB00990AcetaldehydeMetaboCard
ECMDB00051AmmoniaMetaboCard
ECMDB21186AmmoniumMetaboCard
ECMDB00149EthanolamineMetaboCard
GO Classification:
Function
ammonia-lyase activity
carbon-nitrogen lyase activity
catalytic activity
ethanolamine ammonia-lyase activity
lyase activity
Process
cellular amino acid and derivative metabolic process
cellular amino acid metabolic process
cellular metabolic process
metabolic process
Gene Properties
Blattner:b2440
Gene OrientationCounterclockwise
Centisome Percentage:55.06
Left Sequence End2554432
Right Sequence End2555319
Gene Sequence:
>888 bp
ATGTCACATTATAAAACAGGTCATAAACAACCACGATTTCGTTATTCAGTTCTGGCCCGC
TGCGTGGCGTGGGCAAATATCTCTGTTCAGGTTCTTTTTCCACTCGCTGTCACCTTTACC
CCAGTAATGGCGGCACGTGCGCAGCATGCGGTTCAGCCACGGTTGAGCATGGGAAATACT
ACGGTAACTGCTGATAATAACGTGGAGAAAAATGTCGCGTCGTTTGCCGCAAATGCCGGG
ACATTTTTAAGCAGTCAGCCAGATAGCGATGCGACACGTAACTTTATTACCGGAATGGCC
ACAGCTAAAGCTAACCAGGAAATACAGGAGTGGCTCGGGAAATATGGTACTGCGCGCGTC
AAACTGAATGTCGATAAAGATTTCTCGCTGAAGGATTCTTCGCTGGAAATGCTTTATCCG
ATTTATGATACGCCGACAAATATGTTGTTCACTCAGGGGGCAATACATCGTACAGACGAT
CGTACTCAGTCAAATATTGGTTTTGGCTGGCGTCATTTTTCAGGAAATGACTGGATGGCG
GGGGTGAATACTTTTATCGATCATGATTTATCCCGTAGTCATACCCGCATTGGTGTTGGT
GCGGAATACTGGCGCGATTATCTGAAACTGAGCGCCAATGGTTATATTCGGGCTTCTGGC
TGGAAAAAATCGCCGGATATTGAGGATTATCAGGAACGCCCGGCGAATGGCTGGGATATT
CGTGCTGAGGGCTATTTACCCGCCTGGCCGCAGCTTGGCGCAAGCCTGATGTATGAACAG
TATTATGGCGATGAAGTCGGGCTGTTTGGTAAAGATAAGCGCCAGAAAGACCCGCATGCT
ATTTCTGCCGAGGTGACCTATACGCCAGTGCCTCTTACCCAGCAATAG
Protein Properties
Pfam Domain Function:
Protein Residues:295
Protein Molecular Weight:31781
Protein Theoretical pI:7
Signaling Regions:
  • None
Transmembrane Regions:
  • None
Protein Sequence:
>Ethanolamine ammonia-lyase light chain
MDQKQIEEIVRSVMASMGQAAPAPSEAKCATTNCAAPVTSESCALDLGSAEAKAWIGVEN
PHRADVLTELRRSTVARVCTGRAGPRPRTQALLRFLADHSRSKDTVLKEVPEEWVKAQGL
LEVRSEISDKNLYLTRPDMGRRLCAEAVEALKAQCVANPDVQVVISDGLSTDAITVNYEE
ILPPLMAGLKQAGLKVGTPFFVRYGRVKIEDQIGEILGAKVVILLVGERPGLGQSESLSC
YAVYSPRMATTVEADRTCISNIHQGGTPPVEAAAVIVDLAKRMLEQKASGINMTR
References
External Links:
ResourceLink
Uniprot ID:P19636
Uniprot Name:EUTC_ECOLI
GenBank Gene ID:AP009048
Genebank Protein ID:85674442
Ecogene ID:EG50007
Ecocyc:EG50007
ColiBase:b2440
Kegg Gene:b2440
EchoBASE ID:EB4300
CCDB:EUTC_ECOLI
BacMap:16130365
General Reference:
  • Blattner, F. R., Plunkett, G. 3rd, Bloch, C. A., Perna, N. T., Burland, V., Riley, M., Collado-Vides, J., Glasner, J. D., Rode, C. K., Mayhew, G. F., Gregor, J., Davis, N. W., Kirkpatrick, H. A., Goeden, M. A., Rose, D. J., Mau, B., Shao, Y. (1997). "The complete genome sequence of Escherichia coli K-12." Science 277:1453-1462. Pubmed: 9278503
  • Faust, L. R., Connor, J. A., Roof, D. M., Hoch, J. A., Babior, B. M. (1990). "Cloning, sequencing, and expression of the genes encoding the adenosylcobalamin-dependent ethanolamine ammonia-lyase of Salmonella typhimurium." J Biol Chem 265:12462-12466. Pubmed: 2197274
  • Hayashi, K., Morooka, N., Yamamoto, Y., Fujita, K., Isono, K., Choi, S., Ohtsubo, E., Baba, T., Wanner, B. L., Mori, H., Horiuchi, T. (2006). "Highly accurate genome sequences of Escherichia coli K-12 strains MG1655 and W3110." Mol Syst Biol 2:2006.0007. Pubmed: 16738553
  • Yamamoto, Y., Aiba, H., Baba, T., Hayashi, K., Inada, T., Isono, K., Itoh, T., Kimura, S., Kitagawa, M., Makino, K., Miki, T., Mitsuhashi, N., Mizobuchi, K., Mori, H., Nakade, S., Nakamura, Y., Nashimoto, H., Oshima, T., Oyama, S., Saito, N., Sampei, G., Satoh, Y., Sivasundaram, S., Tagami, H., Horiuchi, T., et, a. l. .. (1997). "Construction of a contiguous 874-kb sequence of the Escherichia coli -K12 genome corresponding to 50.0-68.8 min on the linkage map and analysis of its sequence features." DNA Res 4:91-113. Pubmed: 9205837