Identification
Name:N-acetylglucosamine-6-phosphate deacetylase
Synonyms:
  • GlcNAc 6-P deacetylase
Gene Name:nagA
Enzyme Class:
Biological Properties
General Function:Involved in hydrolase activity
Specific Function:N-acetyl-D-glucosamine 6-phosphate + H(2)O = D-glucosamine 6-phosphate + acetate
Cellular Location:Cytoplasmic
SMPDB Pathways:
  • 1,6-anhydro-<i>N</i>-acetylmuramic acid recycling PW002064
  • Amino sugar and nucleotide sugar metabolism I PW000886
  • Amino sugar and nucleotide sugar metabolism II PW000887
  • Amino sugar and nucleotide sugar metabolism III PW000895
  • Galactose metabolism PW000821
  • N-acetylneuraminate and N-acetylmannosamine and N-acetylglucosamine degradation PW002030
KEGG Pathways:
  • Amino sugar and nucleotide sugar metabolism ec00520
  • Galactose metabolism ec00052
KEGG Reactions:
Thumb+ThumbThumb+Thumb
Thumb+ThumbThumb+Thumb
SMPDB Reactions:
N-Acetyl-D-Glucosamine 6-Phosphate+Thumb+ThumbThumb+Thumb
Thumb+ThumbD-glucosamine 6-phosphate+Thumb
EcoCyc Reactions:
Thumb+ThumbThumb+Thumb
Metabolites:
ECMDB IDNameView
ECMDB00042Acetic acidMetaboCard
ECMDB01254Glucosamine 6-phosphateMetaboCard
ECMDB01062N-Acetyl-D-Glucosamine 6-PhosphateMetaboCard
ECMDB00494WaterMetaboCard
GO Classification:
Function
catalytic activity
hydrolase activity
hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds
hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds, in linear amides
N-acetylglucosamine-6-phosphate deacetylase activity
Process
alcohol metabolic process
amino sugar metabolic process
glucosamine metabolic process
metabolic process
monosaccharide metabolic process
N-acetylglucosamine metabolic process
small molecule metabolic process
Gene Properties
Blattner:b0677
Gene OrientationCounterclockwise
Centisome Percentage:15.11
Left Sequence End700826
Right Sequence End701974
Gene Sequence:
>1149 bp
ATGTATGCATTAACCCAGGGCCGGATCTTTACCGGCCACGAATTTCTTGATGACCACGCG
GTTGTTATCGCTGATGGCCTGATTAAAAGCGTCTGTCCGGTAGCGGAACTGCCGCCAGAG
ATCGAACAACGTTCACTGAACGGGGCCATTCTCTCCCCCGGTTTTATCGATGTGCAGTTA
AACGGCTGCGGCGGCGTACAGTTTAACGACACCGCTGAAGCGGTCAGCGTGGAAACGCTG
GAAATCATGCAGAAAGCCAATGAGAAATCAGGCTGTACTAACTATCTGCCGACGCTTATC
ACCACCAGCGATGAGCTGATGAAACAGGGCGTGCGCGTTATGCGCGAGTACCTGGCAAAA
CATCCGAATCAGGCGTTAGGTCTGCATCTGGAAGGTCCGTGGCTGAATCTGGTAAAAAAA
GGCACCCATAATCCGAATTTTGTGCGTAAGCCTGATGCCGCGCTGGTCGATTTCCTGTGT
GAAAACGCCGACGTCATTACCAAAGTGACCCTGGCACCGGAAATGGTTCCTGCGGAAGTC
ATCAGCAAACTGGCAAATGCCGGGATTGTGGTTTCTGCCGGTCACTCCAACGCGACGTTG
AAAGAAGCAAAAGCCGGTTTCCGCGCGGGGATTACCTTTGCCACCCATCTGTACAACGCG
ATGCCGTATATTACCGGTCGTGAACCTGGCCTGGCGGGCGCGATCCTCGACGAAGCTGAC
ATTTATTGCGGTATTATTGCTGATGGCCTGCATGTTGATTACGCCAACATTCGCAACGCT
AAACGTCTGAAAGGCGACAAACTGTGTCTGGTTACTGACGCCACCGCGCCAGCAGGTGCC
AACATTGAACAGTTCATTTTTGCGGGTAAAACAATATACTACCGTAACGGACTTTGTGTG
GATGAGAACGGTACGTTAAGCGGTTCATCCTTAACCATGATTGAAGGCGTGCGTAATCTG
GTCGAACATTGCGGTATCGCACTGGATGAAGTGCTACGTATGGCGACGCTCTATCCGGCG
CGTGCGATTGGCGTTGAGAAACGTCTCGGCACACTCGCCGCAGGTAAAGTAGCCAACCTG
ACTGCATTCACACCTGATTTTAAAATCACCAAGACCATCGTTAACGGTAACGAGGTCGTA
ACTCAATAA
Protein Properties
Pfam Domain Function:
Protein Residues:382
Protein Molecular Weight:40949
Protein Theoretical pI:6
PDB File:1YMY
Signaling Regions:
  • None
Transmembrane Regions:
  • None
Protein Sequence:
>N-acetylglucosamine-6-phosphate deacetylase
MYALTQGRIFTGHEFLDDHAVVIADGLIKSVCPVAELPPEIEQRSLNGAILSPGFIDVQL
NGCGGVQFNDTAEAVSVETLEIMQKANEKSGCTNYLPTLITTSDELMKQGVRVMREYLAK
HPNQALGLHLEGPWLNLVKKGTHNPNFVRKPDAALVDFLCENADVITKVTLAPEMVPAEV
ISKLANAGIVVSAGHSNATLKEAKAGFRAGITFATHLYNAMPYITGREPGLAGAILDEAD
IYCGIIADGLHVDYANIRNAKRLKGDKLCLVTDATAPAGANIEQFIFAGKTIYYRNGLCV
DENGTLSGSSLTMIEGVRNLVEHCGIALDEVLRMATLYPARAIGVEKRLGTLAAGKVANL
TAFTPDFKITKTIVNGNEVVTQ
References
External Links:
ResourceLink
Uniprot ID:P0AF18
Uniprot Name:NAGA_ECOLI
GenBank Gene ID:AF052007
Genebank Protein ID:3005595
PDB ID:1YMY
Ecogene ID:EG10632
Ecocyc:EG10632
ColiBase:b0677
Kegg Gene:b0677
EchoBASE ID:EB0626
CCDB:NAGA_ECOLI
BacMap:16128653
General Reference:
  • Blattner, F. R., Plunkett, G. 3rd, Bloch, C. A., Perna, N. T., Burland, V., Riley, M., Collado-Vides, J., Glasner, J. D., Rode, C. K., Mayhew, G. F., Gregor, J., Davis, N. W., Kirkpatrick, H. A., Goeden, M. A., Rose, D. J., Mau, B., Shao, Y. (1997). "The complete genome sequence of Escherichia coli K-12." Science 277:1453-1462. Pubmed: 9278503
  • Hayashi, K., Morooka, N., Yamamoto, Y., Fujita, K., Isono, K., Choi, S., Ohtsubo, E., Baba, T., Wanner, B. L., Mori, H., Horiuchi, T. (2006). "Highly accurate genome sequences of Escherichia coli K-12 strains MG1655 and W3110." Mol Syst Biol 2:2006.0007. Pubmed: 16738553
  • Minagawa, S., Ogasawara, H., Kato, A., Yamamoto, K., Eguchi, Y., Oshima, T., Mori, H., Ishihama, A., Utsumi, R. (2003). "Identification and molecular characterization of the Mg2+ stimulon of Escherichia coli." J Bacteriol 185:3696-3702. Pubmed: 12813061
  • Oshima, T., Aiba, H., Baba, T., Fujita, K., Hayashi, K., Honjo, A., Ikemoto, K., Inada, T., Itoh, T., Kajihara, M., Kanai, K., Kashimoto, K., Kimura, S., Kitagawa, M., Makino, K., Masuda, S., Miki, T., Mizobuchi, K., Mori, H., Motomura, K., Nakamura, Y., Nashimoto, H., Nishio, Y., Saito, N., Horiuchi, T., et, a. l. .. (1996). "A 718-kb DNA sequence of the Escherichia coli K-12 genome corresponding to the 12.7-28.0 min region on the linkage map." DNA Res 3:137-155. Pubmed: 8905232
  • Peri, K. G., Goldie, H., Waygood, E. B. (1990). "Cloning and characterization of the N-acetylglucosamine operon of Escherichia coli." Biochem Cell Biol 68:123-137. Pubmed: 2190615
  • Plumbridge, J. A. (1989). "Sequence of the nagBACD operon in Escherichia coli K12 and pattern of transcription within the nag regulon." Mol Microbiol 3:505-515. Pubmed: 2668691