Identification
Name:Acetate kinase
Synonyms:
  • Acetokinase
Gene Name:ackA
Enzyme Class:
Biological Properties
General Function:Involved in kinase activity
Specific Function:Involved in the activation of acetate to acetyl CoA and the secretion of acetate. During anaerobic growth of the organism, this enzyme is also involved in the synthesis of most of the ATP formed catabolically
Cellular Location:Cytoplasm
SMPDB Pathways:
KEGG Pathways:
KEGG Reactions:
Thumb+ThumbThumb+Thumb
Thumb+ThumbThumb+Thumb
Thumb+ThumbThumb+Thumb
Thumb+ThumbThumb+Thumb
SMPDB Reactions:
Adenosine diphosphate+propanoyl phosphate+Thumb+ThumbThumb+Thumb
Adenosine diphosphate + propanoyl phosphate + ADP + Propanoyl phosphateAdenosine triphosphate + Propionic acid
ReactionCard
Thumb+ThumbThumb+Thumb
EcoCyc Reactions:
Thumb+ThumbThumb+Thumb
Thumb+ThumbThumb+Thumb
Thumb+ThumbThumb+Thumb
Thumb+ThumbThumb+Thumb
Complex Reactions:
Thumb+ThumbThumb+Thumb
Thumb+ThumbThumb+Thumb
Thumb+ThumbThumb+Thumb
Thumb+ThumbThumb+Thumb
Metabolites:
ECMDB IDNameView
ECMDB00042Acetic acidMetaboCard
ECMDB01494AcetylphosphateMetaboCard
ECMDB00538Adenosine triphosphateMetaboCard
ECMDB01341ADPMetaboCard
ECMDB20184Propanoyl phosphateMetaboCard
ECMDB00237Propionic acidMetaboCard
GO Classification:
Component
cell part
intracellular
Function
catalytic activity
kinase activity
phosphotransferase activity, carboxyl group as acceptor
transferase activity
transferase activity, transferring phosphorus-containing groups
Process
cellular metabolic process
metabolic process
organic acid metabolic process
phosphate metabolic process
phosphorus metabolic process
phosphorylation
Gene Properties
Blattner:b2296
Gene OrientationClockwise
Centisome Percentage:51.98
Left Sequence End2411492
Right Sequence End2412694
Gene Sequence:
>1203 bp
ATGACGCAATACTCCTCTCTCCTTCGTGGTCTTGCAGCGGGTTCTGCATTTTTATTCCTT
TTTGCCCCAACGGCATTCGCGGCGGAACAAACCGTTGAAGCGCCGAGCGTGGATGCGCGT
GCATGGATTTTAATGGATTACGCCAGCGGTAAAGTGCTGGCAGAAGGCAATGCGGATGAG
AAACTGGATCCCGCGAGCCTGACTAAAATCATGACCAGCTATGTGGTTGGGCAGGCGCTT
AAGGCCGATAAGATTAAACTCACCGATATGGTGACGGTCGGTAAAGATGCCTGGGCGACG
GGAAATCCGGCACTGCGTGGTTCATCGGTAATGTTCCTCAAACCGGGCGATCAGGTTTCG
GTGGCAGACTTGAACAAAGGTGTGATTATCCAGTCCGGTAATGACGCCTGTATTGCGCTG
GCTGATTACGTTGCCGGGAGCCAGGAGTCATTTATTGGTCTGATGAATGGTTATGCCAAA
AAACTGGGTCTGACCAACACTACCTTCCAGACGGTGCACGGCCTGGATGCGCCGGGGCAG
TTCAGCACCGCGCGCGATATGGCATTGCTGGGTAAAGCATTGATCCACGATGTGCCGGAA
GAGTACGCCATTCATAAAGAGAAAGAGTTCACCTTCAACAAAATTCGTCAGCCTAACCGT
AACCGTCTGCTGTGGAGCAGCAATCTGAATGTTGATGGCATGAAGACAGGAACCACGGCA
GGCGCGGGATATAATCTGGTTGCTTCGGCTACCCAGGGCGATATGCGTTTAATCTCCGTA
GTGTTGGGGGCGAAAACCGACCGTATCCGTTTTAATGAGTCTGAGAAATTATTGACCTGG
GGTTTCCGCTTCTTTGAAACCGTGACGCCAATTAAACCTGATGCCACCTTTGTGACTCAG
CGCGTCTGGTTTGGTGATAAGAGCGAAGTGAATCTCGGGGCAGGTGAAGCGGGCTCAGTG
ACCATACCGCGTGGGCAGCTGAAAAACCTGAAAGCGAGTTATACGTTAACGGAACCGCAG
CTTACCGCACCGCTGAAAAAAGGTCAGGTTGTCGGGACCATTGATTTCCAGCTTAACGGT
AAATCCATTGAGCAGCGTCCGCTGATCGTGATGGAAAATGTGGAAGAGGGCGGATTCTTT
GGTCGGGTGTGGGATTTCGTGATGATGAAATTCCATCAGTGGTTCGGCAGCTGGTTCTCT
TAA
Protein Properties
Pfam Domain Function:
Protein Residues:400
Protein Molecular Weight:43290
Protein Theoretical pI:6
Signaling Regions:
  • None
Transmembrane Regions:
  • None
Protein Sequence:
>Acetate kinase
MSSKLVLVLNCGSSSLKFAIIDAVNGEEYLSGLAECFHLPEARIKWKMDGNKQEAALGAG
AAHSEALNFIVNTILAQKPELSAQLTAIGHRIVHGGEKYTSSVVIDESVIQGIKDAASFA
PLHNPAHLIGIEEALKSFPQLKDKNVAVFDTAFHQTMPEESYLYALPYNLYKEHGIRRYG
AHGTSHFYVTQEAAKMLNKPVEELNIITCHLGNGGSVSAIRNGKCVDTSMGLTPLEGLVM
GTRSGDIDPAIIFHLHDTLGMSVDAINKLLTKESGLLGLTEVTSDCRYVEDNYATKEDAK
RAMDVYCHRLAKYIGAYTALMDGRLDAVVFTGGIGENAAMVRELSLGKLGVLGFEVDHER
NLAARFGKSGFINKEGTRPAVVIPTNEELVIAQDASRLTA
References
External Links:
ResourceLink
Uniprot ID:P0A6A3
Uniprot Name:ACKA_ECOLI
GenBank Gene ID:AP009048
Genebank Protein ID:1651381
Ecogene ID:EG10027
Ecocyc:EG10027
ColiBase:b2296
Kegg Gene:b2296
EchoBASE ID:EB0026
CCDB:ACKA_ECOLI
BacMap:16130231
General Reference:
  • Blattner, F. R., Plunkett, G. 3rd, Bloch, C. A., Perna, N. T., Burland, V., Riley, M., Collado-Vides, J., Glasner, J. D., Rode, C. K., Mayhew, G. F., Gregor, J., Davis, N. W., Kirkpatrick, H. A., Goeden, M. A., Rose, D. J., Mau, B., Shao, Y. (1997). "The complete genome sequence of Escherichia coli K-12." Science 277:1453-1462. Pubmed: 9278503
  • Hayashi, K., Morooka, N., Yamamoto, Y., Fujita, K., Isono, K., Choi, S., Ohtsubo, E., Baba, T., Wanner, B. L., Mori, H., Horiuchi, T. (2006). "Highly accurate genome sequences of Escherichia coli K-12 strains MG1655 and W3110." Mol Syst Biol 2:2006.0007. Pubmed: 16738553
  • Kakuda, H., Hosono, K., Shiroishi, K., Ichihara, S. (1994). "Identification and characterization of the ackA (acetate kinase A)-pta (phosphotransacetylase) operon and complementation analysis of acetate utilization by an ackA-pta deletion mutant of Escherichia coli." J Biochem 116:916-922. Pubmed: 7883769
  • Matsuyama, A., Yamamoto, H., Nakano, E. (1989). "Cloning, expression, and nucleotide sequence of the Escherichia coli K-12 ackA gene." J Bacteriol 171:577-580. Pubmed: 2536666
  • Yamamoto, Y., Aiba, H., Baba, T., Hayashi, K., Inada, T., Isono, K., Itoh, T., Kimura, S., Kitagawa, M., Makino, K., Miki, T., Mitsuhashi, N., Mizobuchi, K., Mori, H., Nakade, S., Nakamura, Y., Nashimoto, H., Oshima, T., Oyama, S., Saito, N., Sampei, G., Satoh, Y., Sivasundaram, S., Tagami, H., Horiuchi, T., et, a. l. .. (1997). "Construction of a contiguous 874-kb sequence of the Escherichia coli -K12 genome corresponding to 50.0-68.8 min on the linkage map and analysis of its sequence features." DNA Res 4:91-113. Pubmed: 9205837