Canmetcon
Identification
Name:Uncharacterized MFS-type transporter ycaD
Synonyms:Not Available
Gene Name:ycaD
Enzyme Class:Not Available
Biological Properties
General Function:Involved in transmembrane transport
Specific Function:Specific function unknown
Cellular Location:Cell inner membrane; Multi-pass membrane protein
SMPDB Pathways:Not Available
KEGG Pathways:Not Available
Metabolites:
ECMDB IDNameView
GO Classification:
Process
establishment of localization
transmembrane transport
transport
Gene Properties
Blattner:Not Available
Gene OrientationNot Available
Centisome Percentage:Not Available
Left Sequence EndNot Available
Right Sequence EndNot Available
Gene Sequence:
>1149 bp
TTGATTAAGTCAGCGCTATTGGTTCTGGAAGACGGAACCCAGTTTCACGGTCGGGCCATA
GGGGCAACAGGTTCGGCGGTTGGGGAAGTCGTTTTCAATACTTCAATGACCGGTTATCAA
GAAATCCTCACTGATCCTTCCTATTCTCGTCAAATCGTTACTCTTACTTATCCCCATATT
GGCAATGTCGGCACTAATGACGCCGATGAAGAATCTTCTCAGGTACATGCACAAGGTCTG
GTGATTCGCGACCTGCCGCTGATTGCCAGCAACTTCCGTAATACCGAAGACCTCTCTTCT
TACCTGAAGCGCCATAACATCGTGGCGATTGCCGATATCGATACCCGTAAGCTGACGCGT
TTACTGCGCGAGAAAGGCGCACAGAATGGCTGCATTATCGCAGGCGATAACCCGGATGCG
GCGCTGGCGTTAGAAAAAGCCCGCGCGTTCCCAGGTCTGAATGGCATGGATCTGGCAAAA
GAAGTGACCACCGCAGAAGCCTATAGCTGGACACAAGGGAGCTGGACGTTGACCGGCGGC
CTGCCAGAAGCGAAAAAAGAAGACGAGCTGCCGTTCCACGTCGTGGCTTATGATTTTGGT
GCCAAACGCAACATCCTGCGGATGCTGGTGGATAGAGGCTGTCGCCTGACCATCGTTCCG
GCGCAAACTTCTGCGGAAGATGTGCTGAAAATGAATCCAGACGGCATCTTCCTCTCCAAC
GGTCCTGGCGACCCGGCCCCGTGCGATTACGCCATTACCGCCATCCAGAAATTCCTCGAA
ACCGATATTCCGGTCTTCGGCATCTGCCTCGGTCATCAGCTGCTGGCGCTGGCGAGCGGT
GCGAAGACTGTCAAAATGAAATTTGGTCACCACGGCGGCAACCATCCGGTTAAAGATGTG
GAGAAAAACGTGGTGATGATCACCGCCCAGAACCACGGTTTTGCGGTGGATGAAGCAACA
TTACCTGCAAACCTGCGTGTCACGCATAAATCCCTGTTCGACGGTACGTTACAGGGCATT
CATCGCACCGATAAACCGGCGTTCAGCTTCCAGGGTCACCCTGAAGCCAGCCCTGGTCCA
CACGACGCCGCGCCGTTGTTCGACCACTTTATCGAGTTAATTGAGCAGTACCGTAAAACC
GCTAAGTAA
Protein Properties
Pfam Domain Function:
Protein Residues:382
Protein Molecular Weight:41459
Protein Theoretical pI:10
Signaling Regions:
  • None
Transmembrane Regions:
  • 14-34
  • 45-65
  • 79-99
  • 102-122
  • 131-151
  • 157-177
  • 204-224
  • 235-255
  • 270-290
  • 291-311
  • 325-345
  • 348-368
Protein Sequence:
>Uncharacterized MFS-type transporter ycaD
MSTYTRPVMLLLSGLLLLTLAIAVLNTLVPLWLAQEHMSTWQVGVVSSSYFTGNLVGTLL
TGYVIKRIGFNRSYYLASFIFAAGCAGLGLMIGFWSWLAWRFVAGVGCAMIWVVVESALM
CSGTSRNRGRLLAAYMMVYYVGTFLGQLLVSKVSTELMSVLPWVTGLTLAGILPLLFTRV
LNQQAENHDSTSITSMLKLRQARLGVNGCIISGIVLGSLYGLMPLYLNHKGVSNASIGFW
MAVLVSAGILGQWPIGRLADKFGRLLVLRVQVFVVILGSIAMLSQAAMAPALFILGAAGF
TLYPVAMAWACEKVEHHQLVAMNQALLLSYTVGSLLGPSFTAMLMQNFSDNLLFIMIASV
SFIYLLMLLRNAGHTPKPVAHV
References
External Links:
ResourceLink
Uniprot ID:Q8XEB7
Uniprot Name:YCAD_ECO57
GenBank Gene ID:AE005174
Genebank Protein ID:12512718
EchoBASE ID:EB1224
CCDB:YCAD_ECO57
General Reference:
  • Hayashi, T., Makino, K., Ohnishi, M., Kurokawa, K., Ishii, K., Yokoyama, K., Han, C. G., Ohtsubo, E., Nakayama, K., Murata, T., Tanaka, M., Tobe, T., Iida, T., Takami, H., Honda, T., Sasakawa, C., Ogasawara, N., Yasunaga, T., Kuhara, S., Shiba, T., Hattori, M., Shinagawa, H. (2001). "Complete genome sequence of enterohemorrhagic Escherichia coli O157:H7 and genomic comparison with a laboratory strain K-12." DNA Res 8:11-22. Pubmed: 11258796
  • Perna, N. T., Plunkett, G. 3rd, Burland, V., Mau, B., Glasner, J. D., Rose, D. J., Mayhew, G. F., Evans, P. S., Gregor, J., Kirkpatrick, H. A., Posfai, G., Hackett, J., Klink, S., Boutin, A., Shao, Y., Miller, L., Grotbeck, E. J., Davis, N. W., Lim, A., Dimalanta, E. T., Potamousis, K. D., Apodaca, J., Anantharaman, T. S., Lin, J., Yen, G., Schwartz, D. C., Welch, R. A., Blattner, F. R. (2001). "Genome sequence of enterohaemorrhagic Escherichia coli O157:H7." Nature 409:529-533. Pubmed: 11206551