Canmetcon
Identification
Name:Lysophospholipid transporter lplT
Synonyms:Not Available
Gene Name:lplT
Enzyme Class:Not Available
Biological Properties
General Function:Involved in lipid transporter activity
Specific Function:Catalyzes the facilitated diffusion of 2-acyl-glycero-3- phosphoethanolamine (2-acyl-GPE) into the cell
Cellular Location:Cell inner membrane; Multi-pass membrane protein
SMPDB Pathways:Not Available
KEGG Pathways:Not Available
Metabolites:
ECMDB IDNameView
GO Classification:
Process
establishment of localization
transmembrane transport
transport
Gene Properties
Blattner:Not Available
Gene OrientationNot Available
Centisome Percentage:Not Available
Left Sequence EndNot Available
Right Sequence EndNot Available
Gene Sequence:
>1194 bp
ATGTCGACACTAAGCCAAACACCATCACCTCATCATCAGCACGCATACTGGGGCGGTATT
TTTGCCATGACCCTGTGCGTGTTTGTGCTGATTGCTTCTGAATTTATGCCCGTCAGCCTG
CTCACGCCGATTGCCCGTGACCTGGGCGTGACGGAGGGGCTGGCAGGGCGGGGGATTGCT
ATCTCCGGTGCGCTGGCGGTTCTGACCAGCCTGACGCTTTCAACGCTAGCTGGAAAGATG
AATCGTAAGTTCCTGCTGCTGGGGATGACGGTTCTGATGGCCGTATCGGGGCTTATTATT
GCGCTGGCTACCAGTTATCTGATGTATATGGTCGGTCGTGCGATGATTGGTGTGGCCATT
GGCGGATTCTGGTCGATGTCAGCGGCAACGGCGATTCGTCTGGTGCCGCAGCATCAGGTC
ACGCGTGCGCTGGCGATTTTCAACGCCGGTAATGCGCTGGCGACGGTCGTGGCCGCGCCG
CTGGGAAGCTATCTGGGGGCTACGGTCGGATGGCGAGGCGCTTTCTTGTGCTTGGTGCCC
ATGGCGGTTGTCGCCTTTATCTGGCAGTGCATTAGTCTGCCCAGCATGGATGCGAATAAA
AGCCACACGTCATGTGGCGCGGTATTCCGCTTATTTAGCCGCCGCATGGTTGTGGTCGGC
ATGATAGCTTGTGGCCTGTTTTTCATGGGGCAGTTTGCGCTATTCACCTATGTGCGCCCA
TTTCTGGAGTCGGTGACACGGGTTAATTCCTTAGGCTTGTCGTTGATTTTGCTGATTATC
GGCGTGGCCGGTTTTATTGGCACGCTGGTTGTTTCGATATTTCTCAACAGAAAATGCTAC
CCCACGCTGATGGCCATACCCGGACTGATGGCCGTCATTGCCATCGGTCTGATGCTTACC
GGGCATCACGTCTGGATGGTCTCGCTGCTGTTAGGACTCTGGGGCATGCTGGCCACCGCC
GCGCCAACCGGATGGTGGACATGGATTGCGCGTACGTTGCCTGACAACGCCGAAGCCGGA
GGCGGGCTCATGGTCGCGGTGATTCAGCTCTCAATCGCCCTTGGATCAACGGCAGGAGGC
ATCGTGTTTGACCGCCTTGGCTGGCAGAGTACGTTTGCCATGAGTAGTGTGCTGCTCCTT
TGCGCGGGCGTACTGACCTTTGTTACAGCACGCCAGAAGGCCGGTGCGCTTTAG
Protein Properties
Pfam Domain Function:
Protein Residues:397
Protein Molecular Weight:41638
Protein Theoretical pI:10
Signaling Regions:
  • None
Transmembrane Regions:
  • 18-38
  • 53-73
  • 91-111
  • 145-165
  • 167-187
  • 227-247
  • 257-277
  • 281-301
  • 305-325
  • 344-364
  • 367-387
Protein Sequence:
>Lysophospholipid transporter lplT
MSESVHTNTSLWSKGMKAVIVAQFLSAFGDNALLFATLALLKAQFYPEWSQPILQMVFVG
AYILFAPFVGQVADSFAKGRVMMFANGLKLLGAASICFGINPFLGYTLVGVGAAAYSPAK
YGILGELTTGSKLVKANGLMEASTIAAILLGSVAGGVLADWHVLVALAACALAYGGAVVA
NIYIPKLAAARPGQSWNLINMTRSFLNACTSLWRNGETRFSLVGTSLFWGAGVTLRFLLV
LWVPVALGITDNATPTYLNAMVAIGIVVGAGAAAKLVTLETVSRCMPAGILIGVVVLIFS
LQHEQLPAYALLMLIGVLGGFFVVPLNALLQERGKKSVGAGNAIAVQNLGENSAMLLMLG
IYSLAVMVGIPVVPIGIGFGALFALAITALWIWQRRH
References
External Links:
ResourceLink
Uniprot ID:Q8X4N7
Uniprot Name:LPLT_ECO57
GenBank Gene ID:AE005174
Genebank Protein ID:12513065
EchoBASE ID:EB2349
CCDB:LPLT_ECO57
General Reference:
  • Hayashi, T., Makino, K., Ohnishi, M., Kurokawa, K., Ishii, K., Yokoyama, K., Han, C. G., Ohtsubo, E., Nakayama, K., Murata, T., Tanaka, M., Tobe, T., Iida, T., Takami, H., Honda, T., Sasakawa, C., Ogasawara, N., Yasunaga, T., Kuhara, S., Shiba, T., Hattori, M., Shinagawa, H. (2001). "Complete genome sequence of enterohemorrhagic Escherichia coli O157:H7 and genomic comparison with a laboratory strain K-12." DNA Res 8:11-22. Pubmed: 11258796
  • Perna, N. T., Plunkett, G. 3rd, Burland, V., Mau, B., Glasner, J. D., Rose, D. J., Mayhew, G. F., Evans, P. S., Gregor, J., Kirkpatrick, H. A., Posfai, G., Hackett, J., Klink, S., Boutin, A., Shao, Y., Miller, L., Grotbeck, E. J., Davis, N. W., Lim, A., Dimalanta, E. T., Potamousis, K. D., Apodaca, J., Anantharaman, T. S., Lin, J., Yen, G., Schwartz, D. C., Welch, R. A., Blattner, F. R. (2001). "Genome sequence of enterohaemorrhagic Escherichia coli O157:H7." Nature 409:529-533. Pubmed: 11206551