Canmetcon
Identification
Name:Zinc transporter zitB
Synonyms:Not Available
Gene Name:zitB
Enzyme Class:Not Available
Biological Properties
General Function:Involved in cation transmembrane transporter activity
Specific Function:Involved in zinc efflux across the cytoplasmic membrane, thus reducing zinc accumulation in the cytoplasm and rendering bacteria more resistant to zinc. It may contribute to zinc homeostasis at low concentrations of zinc
Cellular Location:Cell inner membrane; Multi-pass membrane protein
SMPDB Pathways:Not Available
KEGG Pathways:Not Available
Metabolites:
ECMDB IDNameView
GO Classification:
Component
cell part
membrane
Function
cation transmembrane transporter activity
ion transmembrane transporter activity
substrate-specific transmembrane transporter activity
transmembrane transporter activity
transporter activity
Process
cation transport
establishment of localization
ion transport
transmembrane transport
transport
Gene Properties
Blattner:Not Available
Gene OrientationNot Available
Centisome Percentage:Not Available
Left Sequence EndNot Available
Right Sequence EndNot Available
Gene Sequence:
>936 bp
ATGGCGCACTCACACACGTCCTCACACCTGCCAGAAGATAATAATGCTCGTCGCTTGTTG
TATGCTTTCGGCGTGACTGCCGGGTTTATGCTGGTAGAAGTCATTGGTGGTTTTCTTTCC
GGTTCTCTGGCTTTGCTGGCCGATGCGGGTCATATGTTGACCGATACTGCCGCCCTGCTT
TTCGCCCTACTCGCCGTGCAATTTTCACGTCGTCCTCCCACCATTCGCCACACTTTCGGT
TGGCTAAGATTGACCACGCTCGCGGCGTTTGTGAATGCCATCGCCCTCGTGGTAATTACC
ATTTTGATTGTCTGGGAGGCGATAGAACGCTTCCGCACGCCGCGTCCGGTCGAGGGCGGC
ATGATGATGGCAATTGCCGTGGCTGGGTTGCTGGCAAATATACTTTCTTTCTGGTTACTT
CATCACGGCAGCGAAGAGAAAAACCTCAACGTACGAGCAGCGGCACTGCATGTGCTCGGG
GACCTGCTGGGTTCGGTTGGGGCTATTATTGCCGCGTTGATTATTATCTGGACCGGCTGG
ACACCTGCTGACCCCATTCTCTCGATACTGGTGTCGCTTCTGGTTCTGCGTAGCGCGTGG
CGACTGTTGAAAGATAGCGTGAATGAATTACTTGAGGGTGCACCGGTATCGCTGGATATC
GCTGAACTGAAGCGTCGTATGTGCCGGGAAATCCCGGAAGTCCGCAATGTGCACCATGTG
CATGTATGGATGGTAGGCGAGAAGCCGGTGATGACGTTGCATGTGCAGGTGATCCCGCCA
CACGATCACGATGCCTTGTTGGATCAGATCCAACACTACCTGATGGATCACTATCAGATT
GAGCACGCCACCATTCAGATGGAATATCAACCTTGTCATGGGCCAGACTGCCACCTGAAT
GAAGGGGTGTCTGGCCATTCACATCATCACCATTAA
Protein Properties
Pfam Domain Function:
Protein Residues:311
Protein Molecular Weight:34468
Protein Theoretical pI:7
Signaling Regions:
  • None
Transmembrane Regions:
  • 19-39
  • 46-66
  • 88-108
  • 120-140
  • 158-178
  • 180-200
Protein Sequence:
>Zinc transporter zitB
MAHSHTSSHLPEDNNARRLLYAFGVTAGFMLVEVIGGFLSGSLALLADAGHMLTDTAALL
FALLAVQFSRRPPTIRHTFGWLRLTTLAAFVNAIALVVITILIVWEAIERFRTPRPVEGG
MMMAIAVAGLLANILSFWLLHHGSEEKNLNVRAAALHVLGDLLGSVGAIIAALIIIWTGW
TPADPILSILVSLLVLRSAWRLLKDSVNELLEGAPVSLDIAELKRRMCREIPEVRNVHHV
HVWMVGEKPVMTLHVQVIPPHDHDALLDQIQHYLMDHYQIEHATIQMEYQPCHGPDCHLN
EGVSGHSHHHH
References
External Links:
ResourceLink
Uniprot ID:Q8X400
Uniprot Name:ZITB_ECO57
GenBank Gene ID:AE005174
Genebank Protein ID:12513681
EchoBASE ID:EB3426
CCDB:ZITB_ECO57
General Reference:
  • Hayashi, T., Makino, K., Ohnishi, M., Kurokawa, K., Ishii, K., Yokoyama, K., Han, C. G., Ohtsubo, E., Nakayama, K., Murata, T., Tanaka, M., Tobe, T., Iida, T., Takami, H., Honda, T., Sasakawa, C., Ogasawara, N., Yasunaga, T., Kuhara, S., Shiba, T., Hattori, M., Shinagawa, H. (2001). "Complete genome sequence of enterohemorrhagic Escherichia coli O157:H7 and genomic comparison with a laboratory strain K-12." DNA Res 8:11-22. Pubmed: 11258796
  • Perna, N. T., Plunkett, G. 3rd, Burland, V., Mau, B., Glasner, J. D., Rose, D. J., Mayhew, G. F., Evans, P. S., Gregor, J., Kirkpatrick, H. A., Posfai, G., Hackett, J., Klink, S., Boutin, A., Shao, Y., Miller, L., Grotbeck, E. J., Davis, N. W., Lim, A., Dimalanta, E. T., Potamousis, K. D., Apodaca, J., Anantharaman, T. S., Lin, J., Yen, G., Schwartz, D. C., Welch, R. A., Blattner, F. R. (2001). "Genome sequence of enterohaemorrhagic Escherichia coli O157:H7." Nature 409:529-533. Pubmed: 11206551