Canmetcon
Identification
Name:tRNA pseudouridine synthase D
Synonyms:
  • tRNA pseudouridylate synthase D
  • tRNA-uridine isomerase D
Gene Name:truD
Enzyme Class:
Biological Properties
General Function:Involved in protein binding
Specific Function:Responsible for synthesis of pseudouridine from uracil- 13 in transfer RNAs
Cellular Location:Cytoplasmic
SMPDB Pathways:Not Available
KEGG Pathways:Not Available
Metabolites:
ECMDB IDNameView
GO Classification:
Function
binding
catalytic activity
intramolecular transferase activity
isomerase activity
nucleic acid binding
pseudouridine synthase activity
RNA binding
Process
cellular macromolecule metabolic process
macromolecule metabolic process
metabolic process
pseudouridine synthesis
RNA metabolic process
RNA modification
Gene Properties
Blattner:Not Available
Gene OrientationNot Available
Centisome Percentage:Not Available
Left Sequence EndNot Available
Right Sequence EndNot Available
Gene Sequence:
>1050 bp
ATGATTGAGTTTGATAATCTCACTTACCTCCACGGTAAACCGCAAGGCACCGGGCTGCTG
AAAGCCAATCCGGAAGACTTTGTGGTGGTGGAAGATTTGGGCTTTGAGCCTGATGGTGAA
GGTGAGCATATTCTGGTTAGAATCCTCAAAAACGGCTGCAATACCCGTTTTGTGGCGGAT
GCACTGGCGAAATTCCTGAAAATTCATGCCCGTGAAGTCAGCTTCGCTGGGCAAAAAGAC
AAACATGCTGTTACGGAACAGTGGTTATGCGCTCGCGTGCCGGGCAAGGAAATGCCCGAT
CTGAGCGCCTTTCAACTGGAAGGCTGCCAGGTGCTGGAGTATGCGCGGCACAAGCGCAAG
CTGCGTTTAGGCGCGCTGAAAGGTAACGCCTTTACCCTGGTTCTGCGCGAAGTGAGCAAT
CGCGATGACGTTGAACAACGTCTGATCGATATTTGCGTAAAAGGTGTACCGAACTACTTC
GGTGCCCAACGTTTTGGGATTGGCGGTAGCAACTTGCAGGGGGCGCAGCGCTGGGCGCAA
ACCAATACTCCGGTGCGCGATCGCAATAAACGGAGTTTTTGGTTGTCGGCAGCCCGCAGT
GCGTTGTTTAATCAGATTGTTGCTGAGCGCCTCAAAAAAGCAGACGTTAATCAAGTTGTT
GACGGCGATGCGCTACAATTAGCCGGACGTGGTAGCTGGTTTGTCGCAACCACCGAAGAA
CTGGCGGAATTACAGCGTCGCGTCAACGATAAAGAGTTGATGATAACCGCCGCATTGCCA
GGCAGTGGCGAATGGGGAACTCAGCGTGAAGCGCTGGCATTCGAACAAGCAGCTGTCGCC
GCAGAAACTGAATTACAAGCTTTACTGGTGCGCGAAAAAGTTGAAGCCGCGCGCAGAGCG
ATGCTGCTGTATCCGCAACAATTAAGCTGGAATTGGTGGGATGACGTCACCGTAGAGATC
CGTTTCTGGCTTCCGGCGGGTAGTTTTGCAACCAGCGTTGTCAGGGAACTTATCAACACA
ACAGGTGATTATGCGCATATTGCTGAGTAA
Protein Properties
Pfam Domain Function:
Protein Residues:349
Protein Molecular Weight:39091
Protein Theoretical pI:7
PDB File:1SI7
Signaling Regions:
  • None
Transmembrane Regions:
  • None
Protein Sequence:
>tRNA pseudouridine synthase D
MIEFDNLTYLHGKPQGTGLLKANPEDFVVVEDLGFEPDGEGEHILVRILKNGCNTRFVAD
ALAKFLKIHAREVSFAGQKDKHAVTEQWLCARVPGKEMPDLSAFQLEGCQVLEYARHKRK
LRLGALKGNAFTLVLREVSNRDDVEQRLIDICVKGVPNYFGAQRFGIGGSNLQGAQRWAQ
TNTPVRDRNKRSFWLSAARSALFNQIVAERLKKADVNQVVDGDALQLAGRGSWFVATTEE
LAELQRRVNDKELMITAALPGSGEWGTQREALAFEQAAVAAETELQALLVREKVEAARRA
MLLYPQQLSWNWWDDVTVEIRFWLPAGSFATSVVRELINTTGDYAHIAE
References
External Links:
ResourceLink
Uniprot ID:Q57261
Uniprot Name:TRUD_ECOLI
GenBank Gene ID:L07942
Genebank Protein ID:1036738
PDB ID:1SI7
CCDB:TRUD_ECOLI
General Reference:
  • Blattner, F. R., Plunkett, G. 3rd, Bloch, C. A., Perna, N. T., Burland, V., Riley, M., Collado-Vides, J., Glasner, J. D., Rode, C. K., Mayhew, G. F., Gregor, J., Davis, N. W., Kirkpatrick, H. A., Goeden, M. A., Rose, D. J., Mau, B., Shao, Y. (1997). "The complete genome sequence of Escherichia coli K-12." Science 277:1453-1462. Pubmed: 9278503
  • Ericsson, U. B., Andersson, M. E., Engvall, B., Nordlund, P., Hallberg, B. M. (2004). "Expression, purification, crystallization and preliminary diffraction studies of the tRNA pseudouridine synthase TruD from Escherichia coli." Acta Crystallogr D Biol Crystallogr 60:775-776. Pubmed: 15039583
  • Ericsson, U. B., Nordlund, P., Hallberg, B. M. (2004). "X-ray structure of tRNA pseudouridine synthase TruD reveals an inserted domain with a novel fold." FEBS Lett 565:59-64. Pubmed: 15135053
  • Fountoulakis, M., Takacs, M. F., Berndt, P., Langen, H., Takacs, B. (1999). "Enrichment of low abundance proteins of Escherichia coli by hydroxyapatite chromatography." Electrophoresis 20:2181-2195. Pubmed: 10493123
  • Hayashi, K., Morooka, N., Yamamoto, Y., Fujita, K., Isono, K., Choi, S., Ohtsubo, E., Baba, T., Wanner, B. L., Mori, H., Horiuchi, T. (2006). "Highly accurate genome sequences of Escherichia coli K-12 strains MG1655 and W3110." Mol Syst Biol 2:2006.0007. Pubmed: 16738553
  • Hoang, C., Ferre-D'Amare, A. R. (2004). "Crystal structure of the highly divergent pseudouridine synthase TruD reveals a circular permutation of a conserved fold." RNA 10:1026-1033. Pubmed: 15208439
  • Kaya, Y., Del Campo, M., Ofengand, J., Malhotra, A. (2004). "Crystal structure of TruD, a novel pseudouridine synthase with a new protein fold." J Biol Chem 279:18107-18110. Pubmed: 14999002
  • Kaya, Y., Ofengand, J. (2003). "A novel unanticipated type of pseudouridine synthase with homologs in bacteria, archaea, and eukarya." RNA 9:711-721. Pubmed: 12756329
  • Li, C., Ichikawa, J. K., Ravetto, J. J., Kuo, H. C., Fu, J. C., Clarke, S. (1994). "A new gene involved in stationary-phase survival located at 59 minutes on the Escherichia coli chromosome." J Bacteriol 176:6015-6022. Pubmed: 7928962