Identification
Name:Membrane-associated protein UidC
Synonyms:Not Available
Gene Name:uidC
Enzyme Class:Not Available
Biological Properties
General Function:ion transport
Specific Function:Enhances the activity of the UidB (GusB) glucuronide transporter, on its own however it has no transport activity. Glucuronide transport does not occur in strain K12 due to a variant at position 100 of the UidB (GusB, AC P0CE44, AC P0CE45) protein.
Cellular Location:Not Available
SMPDB Pathways:
  • hexuronide and hexuronate degradation PW000834
KEGG Pathways:Not Available
Transports:
    Transport References:Not Available
    Metabolites:
    ECMDB IDNameView
    GO Classification:
    Function
    carbohydrate transport
    cell outer membrane
    ion transport
    pore complex
    porin activity
    Gene Properties
    Blattner:Not Available
    Gene OrientationNot Available
    Centisome Percentage:Not Available
    Left Sequence EndNot Available
    Right Sequence EndNot Available
    Gene Sequence:
    >1266
    atgagaaaaatagtggccatggccgttatttgcctgacggctgcctctggccttacctct
    gcttatgcggcgcaactggctgacgatgaagcgggactacgcatcagactgaaaaacgaa
    ttgcgcagggcggataagcccagtgctggcgcgggaagagatatttacgcatgggtacag
    ggaggattgctcgatttcaatagtggttattattccaatattattggcgttgaaggcggg
    gcgtattatgtttataaattaggtgctcgtgctgatatgagtacccggtggtatcttgat
    ggtgataaaagttttggctttgccctgggggcagtaaaaataaaacccagtgaaaatagc
    ctgcttaaattaggtcgcttcgggacggattatagttatggtagcttaccttatcgtatt
    ccgttaatggctggcagttcgcaacgtacattaccgacagtttctgaaggagcattaggt
    tattgggctttaacaccaaatattgatctgtggggaatgtggcgttcacgagtattttta
    tggactgattcaacaaccggtattcgtgatgaaggggtgtataacagccagacgggaaaa
    tacgataaacatcgcgcacgttcttttttagccgccagttggcatgatgataccagtcgc
    tattctctgggggcatcggtacagaaagatgtttccaatcagatacaaagtattctcgag
    aaaagcataccgctcgacccgaattatacgttgaaaggggagttgctcggcttttacgcg
    cagctcgaaggtttaagtcgtaataccagccagcccaatgaaacggcgttggttagtgga
    caattgacctggaatgcgccgtggggaagtgtatttggcagtggtggttatttgcgccat
    gcaatgaatggtgccgtggtggataccgacattggctatcccttttcattaagtcttgat
    cgtaaccgtgaaggaatgcagtcctggcaattgggcgtcaactatcgtttaacgccgcaa
    tttacgctgacatttgcaccgattgtgactcgcggctatgaatccagtaaacgagatgtg
    cggattgaaggcacgggtatcttaggtggtatgaactatcgggtcagcgaagggccgtta
    caagggatgaatttctttcttgctgccgataaagggcgggaaaagcgcgatggcagtacg
    ctgggcgatcgcctgaattactgggatgtgaaaatgagtattcagtatgactttatgctg
    aagtaa
    Protein Properties
    Pfam Domain Function:Not Available
    Protein Residues:421
    Protein Molecular Weight:46647
    Protein Theoretical pI:Not Available
    Signaling Regions:
    • 1-23
    Transmembrane Regions:Not Available
    Protein Sequence:
    >Membrane-associated protein UidC
    MRKIVAMAVICLTAASGLTSAYAAQLADDEAGLRIRLKNELRRADKPSAGAGRDIYAWVQ
    GGLLDFNSGYYSNIIGVEGGAYYVYKLGARADMSTRWYLDGDKSFGFALGAVKIKPSENS
    LLKLGRFGTDYSYGSLPYRIPLMAGSSQRTLPTVSEGALGYWALTPNIDLWGMWRSRVFL
    WTDSTTGIRDEGVYNSQTGKYDKHRARSFLAASWHDDTSRYSLGASVQKDVSNQIQSILE
    KSIPLDPNYTLKGELLGFYAQLEGLSRNTSQPNETALVSGQLTWNAPWGSVFGSGGYLRH
    AMNGAVVDTDIGYPFSLSLDRNREGMQSWQLGVNYRLTPQFTLTFAPIVTRGYESSKRDV
    RIEGTGILGGMNYRVSEGPLQGMNFFLAADKGREKRDGSTLGDRLNYWDVKMSIQYDFML
    K
    References
    External Links:
    ResourceLink
    Uniprot ID:Q47706
    Uniprot Name:UIDC_ECOLI
    CCDB:UIDC_ECOLI
    General Reference:Not Available