Canmetcon
Identification
Name:Peptide transport periplasmic protein SapA
Synonyms:Not Available
Gene Name:sapA
Enzyme Class:Not Available
Biological Properties
General Function:transmembrane transport
Specific Function:Involved in a peptide intake transport system that plays a role in the resistance to antimicrobial peptides.
Cellular Location:Not Available
SMPDB Pathways:Not Available
KEGG Pathways:
  • Cationic antimicrobial peptide (CAMP) resistance eco01503
Metabolites:
ECMDB IDNameView
GO Classification:
Function
ATP-binding cassette (ABC) transporter complex
peptide transport
periplasmic space
protein transport
transmembrane transport
Gene Properties
Blattner:Not Available
Gene OrientationNot Available
Centisome Percentage:Not Available
Left Sequence EndNot Available
Right Sequence EndNot Available
Gene Sequence:
>1644
atgcgccaggtattatcgtctcttttggtgattgctggacttgtgagtggtcaggcaatc
gccgcgcctgaatctcccccgcatgctgatatccgcgacagcggttttgtctattgcgtc
agcgggcaagtcaacacctttaacccatccaaagcgagcagtgggttaattgtcgatacc
cttgccgcccagttttatgatcgactgctggatgtcgatccctatacctatcgcctgatg
ccggaacttgccgaaagctgggaagtactcgacaacggcgcgacctatcgcttccacctg
cgtcgcgatgttccgtttcaaaaaaccgactggtttactcccactcgtaaaatgaatgcc
gacgatgtggtgtttaccttccagcgaatttttgaccgcaacaacccgtggcataacgtc
aacggcagcaacttcccctacttcgacagcctgcaatttgccgataacgtgaaaagcgtc
cgcaaactggataatcataccgttgagttccgactcgcccagccggatgcttcttttttg
tggcacctcgcaacccattatgcttcggtcatgtcggcagaatatgcccggaagttagag
aaagaagatcgccaggagcaactcgaccgtcaaccggtcggcaccggtccgtatcagttg
tcggaataccgcgccgggcaatttattcgcctacaacgtcatgatgacttctggcgcggt
aaaccgttaatgccgcaggtagtggtggatttaggctccggcggcaccggacgtctgtcg
aaactcctgaccggggaatgcgacgttctggcctggcctgctgccagccagctatccatt
ttgcgtgacgacccgcgcttgcgtttaacgctgcgtcctgggatgaacgtcgcctatctg
gcatttaacaccgccaaaccgccgctaaataatcccgctgtccgccatgcgctggcactg
gcgattaataaccagcgcctgatgcaatccatctattatggtacggctgaaacggcggcc
tctattttaccgcgcgcctcgtgggcctatgacaacgaggctaaaattactgaatacaat
ccggcgaaatcgcgcgaacagttgaagtcgttggggctggaaaatttaacgctgaaactg
tgggtgcccacacgttcgcaggcgtggaaccccagtccactgaaaactgccgaactgatt
caggcggatatggcgcaggttggcgtaaaagtggtgattgtgccggtagaaggtcgcttt
caggaggcgcggttgatggatatgagccatgatctgacgttatccggttgggcgacggac
agtaacgacccggacagtttcttccgtccgttactgagctgcgcggcaattcattcgcag
accaacctcgcccactggtgcgatccgaaattcgacagcgtattgcgtaaggcgctctct
tcgcagcagctggcggcgcgtattgaagcctatgacgaagcgcagagtattctggcgcag
gaattgcccattttgccgctggcgtcgtcattgcgtttgcaggcctatcggtacgatatc
aaaggtctggtacttagcccgtttggtaacgcctcctttgctggggtgtatcgcgagaaa
caggatgaggtgaaaaaaccatga
Protein Properties
Pfam Domain Function:Not Available
Protein Residues:547
Protein Molecular Weight:61564
Protein Theoretical pI:Not Available
Signaling Regions:
  • 1-21
Transmembrane Regions:Not Available
Protein Sequence:
>Peptide transport periplasmic protein SapA
MRQVLSSLLVIAGLVSGQAIAAPESPPHADIRDSGFVYCVSGQVNTFNPSKASSGLIVDT
LAAQFYDRLLDVDPYTYRLMPELAESWEVLDNGATYRFHLRRDVPFQKTDWFTPTRKMNA
DDVVFTFQRIFDRNNPWHNVNGSNFPYFDSLQFADNVKSVRKLDNHTVEFRLAQPDASFL
WHLATHYASVMSAEYARKLEKEDRQEQLDRQPVGTGPYQLSEYRAGQFIRLQRHDDFWRG
KPLMPQVVVDLGSGGTGRLSKLLTGECDVLAWPAASQLSILRDDPRLRLTLRPGMNVAYL
AFNTAKPPLNNPAVRHALALAINNQRLMQSIYYGTAETAASILPRASWAYDNEAKITEYN
PAKSREQLKSLGLENLTLKLWVPTRSQAWNPSPLKTAELIQADMAQVGVKVVIVPVEGRF
QEARLMDMSHDLTLSGWATDSNDPDSFFRPLLSCAAIHSQTNLAHWCDPKFDSVLRKALS
SQQLAARIEAYDEAQSILAQELPILPLASSLRLQAYRYDIKGLVLSPFGNASFAGVYREK
QDEVKKP
References
External Links:
ResourceLink
Uniprot ID:Q47622
Uniprot Name:SAPA_ECOLI
CCDB:SAPA_ECOLI
General Reference:Not Available