Identification
Name:Thiosulfate sulfurtransferase YnjE
Synonyms:Not Available
Gene Name:ynjE
Enzyme Class:
Biological Properties
General Function:Involved in thiosulfate sulfurtransferase activity
Specific Function:Thiosulfate + cyanide = sulfite + thiocyanate
Cellular Location:Periplasm (Potential)
SMPDB Pathways:
KEGG Pathways:
  • Cysteine and methionine metabolism ec00270
  • Microbial metabolism in diverse environments ec01120
  • Sulfur metabolism ec00920
KEGG Reactions:
Thumb+Thumb+ThumbThumb+Thumb+Thumb
Thumb+ThumbThumb+Thumb
Thumb+ThumbThumb+Thumb
Thumb+ThumbThumb+Thumb
EcoCyc Reactions:
Thumb+Thumb+ThumbThumb+Thumb+Thumb
Thumb+ThumbThumb+Thumb+Thumb
Thumb+ThumbThumb+Thumb
Complex Reactions:
Thumb+ThumbThumb+Thumb
Metabolites:
ECMDB IDNameView
ECMDB013683-Mercaptopyruvic acidMetaboCard
ECMDB02084CyanideMetaboCard
ECMDB21231Hydrogen cyanideMetaboCard
ECMDB21225Hydrogen ionMetaboCard
ECMDB00243Pyruvic acidMetaboCard
ECMDB00240SulfiteMetaboCard
ECMDB21289ThiocyanateMetaboCard
ECMDB00257ThiosulfateMetaboCard
GO Classification:
Function
catalytic activity
sulfurtransferase activity
thiosulfate sulfurtransferase activity
transferase activity
transferase activity, transferring sulfur-containing groups
Process
anion transport
establishment of localization
inorganic anion transport
ion transport
sulfate transport
transport
Gene Properties
Blattner:b1757
Gene OrientationClockwise
Centisome Percentage:39.60
Left Sequence End1837491
Right Sequence End1838798
Gene Sequence:
>1308 bp
ATGAAACGTGTTTCTCAAATGACCGCGCTGGCAATGGCTTTAGGGCTGGCTTGCGCTTCT
TCGTGGGCCGCTGAACTGGCGAAGCCTCTTACACTTGACCAGCTTCAACAACAAAATGGC
AAAGCGATAGATACTCGCCCCAGCGCGTTTTATAACGGCTGGCCACAAACCTTAAATGGC
CCTTCTGGTCATGAACTTGCCGCCTTAAACCTCTCTGCCAGCTGGCTTGACAAAATGAGC
ACCGAACAGCTCAACGCGTGGATCAAGCAACATAACCTGAAAACCGATGCTCCGGTGGCG
CTGTACGGTAATGACAAAGATGTCGACGCCGTCAAAACGCGACTGCAAAAAGCAGGTTTA
ACGCATATCTCCATCCTGAGTGACGCGCTAAGCGAACCTTCCCGTCTGCAAAAACTGCCG
CATTTTGAGCAGCTGGTTTATCCGCAATGGCTGCACGACCTGCAACAAGGTAAAGAGGTT
ACGGCGAAACCTGCCGGTGACTGGAAAGTCATTGAAGCGGCCTGGGGCGCTCCTAAGCTT
TACCTTATCAGCCATATTCCCGGCGCTGACTACATCGATACCAACGAAGTGGAAAGTGAA
CCGCTGTGGAACAAAGTTTCTGATGAACAACTAAAAGCGATGCTGGCAAAACACGGCATT
CGCCATGACACCACGGTCATTCTGTATGGGCGTGACGTATACGCTGCAGCGCGTGTGGCG
CAGATTATGCTTTATGCTGGCGTGAAAGATGTGCGCCTGCTGGATGGCGGCTGGCAAACC
TGGTCCGACGCGGGACTGCCTGTTGAGCGCGGAACGCCACCGAAAGTGAAAGCGGAACCG
GATTTCGGCGTGAAGATCCCGGCACAACCGCAGTTGATGCTCGATATGGAACAGGCCCGT
GGACTGCTGCATCGCCAGGATGCATCGCTGGTGAGCATTCGTTCGTGGCCAGAATTTATC
GGTACGACCAGCGGTTACAGCTATATTAAACCAAAAGGTGAAATAGCCGGCGCACGTTGG
GGACACGCTGGTAGCGACTCGACGCATATGGAAGATTTTCATAACCCGGATGGCACCATG
CGCAGCGCCGATGATATTACCGCTATGTGGAAAGCGTGGAATATCAAACCAGAGCAGCAA
GTTTCATTCTACTGCGGCACCGGCTGGCGCGCGTCCGAAACCTTTATGTACGCACGCGCC
ATGGGTTGGAAGAATGTTTCCGTGTATGACGGCGGCTGGTACGAATGGAGCAGCGATCCA
AAAAATCCGGTAGCAACCGGTGAACGCGGCCCGGACAGTAGCAAATAA
Protein Properties
Pfam Domain Function:
Protein Residues:435
Protein Molecular Weight:48228
Protein Theoretical pI:7
Signaling Regions:
  • 1-23
Transmembrane Regions:
  • None
Protein Sequence:
>Thiosulfate sulfurtransferase YnjE
MKRVSQMTALAMALGLACASSWAAELAKPLTLDQLQQQNGKAIDTRPSAFYNGWPQTLNG
PSGHELAALNLSASWLDKMSTEQLNAWIKQHNLKTDAPVALYGNDKDVDAVKTRLQKAGL
THISILSDALSEPSRLQKLPHFEQLVYPQWLHDLQQGKEVTAKPAGDWKVIEAAWGAPKL
YLISHIPGADYIDTNEVESEPLWNKVSDEQLKAMLAKHGIRHDTTVILYGRDVYAAARVA
QIMLYAGVKDVRLLDGGWQTWSDAGLPVERGTPPKVKAEPDFGVKIPAQPQLMLDMEQAR
GLLHRQDASLVSIRSWPEFIGTTSGYSYIKPKGEIAGARWGHAGSDSTHMEDFHNPDGTM
RSADDITAMWKAWNIKPEQQVSFYCGTGWRASETFMYARAMGWKNVSVYDGGWYEWSSDP
KNPVATGERGPDSSK
References
External Links:
ResourceLink
Uniprot ID:P78067
Uniprot Name:YNJE_ECOLI
GenBank Gene ID:AP009048
Genebank Protein ID:85675109
Ecogene ID:EG14007
Ecocyc:EG14007
ColiBase:b1757
Kegg Gene:b1757
EchoBASE ID:EB3763
CCDB:YNJE_ECOLI
BacMap:90111324
General Reference:
  • Aiba, H., Baba, T., Hayashi, K., Inada, T., Isono, K., Itoh, T., Kasai, H., Kashimoto, K., Kimura, S., Kitakawa, M., Kitagawa, M., Makino, K., Miki, T., Mizobuchi, K., Mori, H., Mori, T., Motomura, K., Nakade, S., Nakamura, Y., Nashimoto, H., Nishio, Y., Oshima, T., Saito, N., Sampei, G., Horiuchi, T., et, a. l. .. (1996). "A 570-kb DNA sequence of the Escherichia coli K-12 genome corresponding to the 28.0-40.1 min region on the linkage map." DNA Res 3:363-377. Pubmed: 9097039
  • Blattner, F. R., Plunkett, G. 3rd, Bloch, C. A., Perna, N. T., Burland, V., Riley, M., Collado-Vides, J., Glasner, J. D., Rode, C. K., Mayhew, G. F., Gregor, J., Davis, N. W., Kirkpatrick, H. A., Goeden, M. A., Rose, D. J., Mau, B., Shao, Y. (1997). "The complete genome sequence of Escherichia coli K-12." Science 277:1453-1462. Pubmed: 9278503
  • Hanzelmann, P., Dahl, J. U., Kuper, J., Urban, A., Muller-Theissen, U., Leimkuhler, S., Schindelin, H. (2009). "Crystal structure of YnjE from Escherichia coli, a sulfurtransferase with three rhodanese domains." Protein Sci 18:2480-2491. Pubmed: 19798741
  • Hayashi, K., Morooka, N., Yamamoto, Y., Fujita, K., Isono, K., Choi, S., Ohtsubo, E., Baba, T., Wanner, B. L., Mori, H., Horiuchi, T. (2006). "Highly accurate genome sequences of Escherichia coli K-12 strains MG1655 and W3110." Mol Syst Biol 2:2006.0007. Pubmed: 16738553