Identification
Name:aldehyde oxidoreductase, ethanolamine utilization protein
Synonyms:Not Available
Gene Name:eutE
Enzyme Class:Not Available
Biological Properties
General Function:Not Available
Specific Function:Not Available
Cellular Location:Not Available
SMPDB Pathways:Not Available
KEGG Pathways:
KEGG Reactions:
Thumb+Thumb+ThumbThumb+Thumb+Thumb
Thumb+Thumb+ThumbThumb+Thumb+Thumb
Thumb+Thumb+ThumbThumb+Thumb+Thumb
EcoCyc Reactions:
Thumb+Thumb+ThumbThumb+Thumb+Thumb
Thumb+Thumb+ThumbThumb+Thumb+Thumb
Metabolites:
ECMDB IDNameView
ECMDB00990AcetaldehydeMetaboCard
ECMDB01206Acetyl-CoAMetaboCard
ECMDB01423Coenzyme AMetaboCard
ECMDB21225Hydrogen ionMetaboCard
ECMDB00902NADMetaboCard
ECMDB01487NADHMetaboCard
GO Classification:Not Available
Gene Properties
Blattner:b2455
Gene OrientationNot Available
Centisome Percentage:Not Available
Left Sequence EndNot Available
Right Sequence EndNot Available
Gene Sequence:
>eco:b2455 eutE; aldehyde oxidoreductase, ethanolamine utilization protein; K04021 aldehyde dehydrogenase (N)
ATGAATCAACAGGATATTGAACAGGTGGTGAAAGCGGTACTGCTGAAAATGCAAAGCAGT
GACACGCCGTCCGCCGCCGTTCATGAGATGGGCGTTTTCGCGTCCCTGGATGACGCCGTT
GCGGCAGCCAAAGTCGCCCAGCAAGGGTTAAAAAGCGTGGCAATGCGCCAGTTAGCCATT
GCTGCCATTCGTGAAGCAGGCGAAAAACACGCCAGAGATTTAGCGGAACTTGCCGTCAGT
GAAACCGGCATGGGGCGCGTTGAAGATAAATTTGCAAAAAACGTCGCTCAGGCGCGCGGC
ACACCAGGCGTTGAGTGCCTCTCTCCGCAAGTGCTGACTGGCGACAACGGCCTGACCCTA
ATTGAAAACGCACCCTGGGGCGTGGTGGCTTCGGTGACGCCTTCCACTAACCCGGCGGCA
ACCGTAATTAACAACGCCATCAGCCTGATTGCCGCGGGCAACAGCGTCATTTTTGCCCCG
CATCCGGCGGCGAAAAAAGTCTCCCAGCGGGCGATTACGCTGCTCAACCAGGCGATTGTT
GCCGCAGGTGGGCCGGAAAACTTACTGGTTACTGTGGCAAATCCGGATATCGAAACCGCG
CAACGCTTGTTCAAGTTTCCGGGTATCGGCCTGCTGGTGGTAACCGGCGGCGAAGCGGTA
GTAGAAGCGGCGCGTAAACACACCAATAAACGTCTGATTGCCGCAGGCGCTGGCAACCCG
CCGGTAGTGGTGGATGAAACCGCCGACCTCGCCCGTGCCGCTCAGTCCATCGTCAAAGGC
GCTTCTTTCGATAACAACATCATTTGTGCCGACGAAAAGGTACTGATTGTTGTTGATAGC
GTAGCCGATGAACTGATGCGTCTGATGGAAGGCCAGCACGCGGTGAAACTGACCGCAGAA
CAGGCGCAGCAGCTGCAACCGGTGTTGCTGAAAAATATCGACGAGCGCGGAAAAGGCACC
GTCAGCCGTGACTGGGTTGGTCGCGACGCAGGCAAAATCGCGGCGGCAATCGGCCTTAAA
GTTCCGCAAGAAACGCGCCTGCTGTTTGTGGAAACCACCGCAGAACATCCGTTTGCCGTG
ACTGAACTGATGATGCCGGTGTTGCCCGTCGTGCGCGTCGCCAACGTGGCGGATGCCATT
GCGCTAGCGGTGAAACTGGAAGGCGGTTGCCACCACACGGCGGCAATGCACTCGCGCAAC
ATCGAAAACATGAACCAGATGGCGAATGCTATTGATACCAGCATTTTCGTTAAGAACGGA
CCGTGCATTGCCGGGCTGGGGCTGGGCGGGGAAGGCTGGACCACCATGACCATCACCACG
CCAACCGGTGAAGGGGTAACCAGCGCGCGTACGTTTGTCCGTCTGCGTCGCTGTGTATTA
GTCGATGCGTTTCGCATTGTTTAA
Protein Properties
Pfam Domain Function:Not Available
Protein Residues:Not Available
Protein Molecular Weight:Not Available
Protein Theoretical pI:Not Available
Signaling Regions:Not Available
Transmembrane Regions:Not Available
Protein Sequence:
>eco:b2455 eutE; aldehyde oxidoreductase, ethanolamine utilization protein; K04021 aldehyde dehydrogenase (A)
MNQQDIEQVVKAVLLKMQSSDTPSAAVHEMGVFASLDDAVAAAKVAQQGLKSVAMRQLAI
AAIREAGEKHARDLAELAVSETGMGRVEDKFAKNVAQARGTPGVECLSPQVLTGDNGLTL
IENAPWGVVASVTPSTNPAATVINNAISLIAAGNSVIFAPHPAAKKVSQRAITLLNQAIV
AAGGPENLLVTVANPDIETAQRLFKFPGIGLLVVTGGEAVVEAARKHTNKRLIAAGAGNP
PVVVDETADLARAAQSIVKGASFDNNIICADEKVLIVVDSVADELMRLMEGQHAVKLTAE
QAQQLQPVLLKNIDERGKGTVSRDWVGRDAGKIAAAIGLKVPQETRLLFVETTAEHPFAV
TELMMPVLPVVRVANVADAIALAVKLEGGCHHTAAMHSRNIENMNQMANAIDTSIFVKNG
PCIAGLGLGGEGWTTMTITTPTGEGVTSARTFVRLRRCVLVDAFRIV
References
External Links:
ResourceLink
Uniprot ID:P77445
ColiBase:b2455
Kegg Gene:b2455
EchoBASE ID:EB3937
BacMap:16130380
General Reference:Not Available