Identification
Name:NADP-dependent malic enzyme
Synonyms:
  • NADP-ME
Gene Name:maeB
Enzyme Class:
Biological Properties
General Function:Involved in oxidoreductase activity
Specific Function:(S)-malate + NADP(+) = pyruvate + CO(2) + NADPH
Cellular Location:Not Available
SMPDB Pathways:
KEGG Pathways:
KEGG Reactions:
Thumb+ThumbThumb+Thumb+Thumb
Thumb+ThumbThumb+Thumb+Thumb+Thumb
Thumb+Thumb+ThumbThumb+Thumb+Thumb
SMPDB Reactions:
L-Malic acid+Thumb+ThumbThumb+NADPH+Thumb+Thumb
EcoCyc Reactions:
Thumb+ThumbThumb+Thumb+Thumb
Thumb+ThumbThumb+Thumb+Thumb+Thumb
Complex Reactions:
Thumb+ThumbThumb+Thumb+Thumb
Metabolites:
ECMDB IDNameView
ECMDB04030Carbon dioxideMetaboCard
ECMDB21225Hydrogen ionMetaboCard
ECMDB00156L-Malic acidMetaboCard
ECMDB00217NADPMetaboCard
ECMDB04111NADPHMetaboCard
ECMDB00243Pyruvic acidMetaboCard
GO Classification:
Function
acyltransferase activity
binding
catalytic activity
cation binding
ion binding
metal ion binding
NAD or NADH binding
nucleotide binding
oxidoreductase activity
oxidoreductase activity, acting on CH-OH group of donors
oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor
transferase activity
transferase activity, transferring acyl groups
transferase activity, transferring acyl groups other than amino-acyl groups
Process
metabolic process
oxidation reduction
Gene Properties
Blattner:b2463
Gene OrientationCounterclockwise
Centisome Percentage:55.48
Left Sequence End2574120
Right Sequence End2576399
Gene Sequence:
>2280 bp
ATGAGCGAGCCGTTAATTGTCGGCATCCGGCATCATAGTCCGGCCTGCGCCCGGCTGGTG
AAATCGTTAATCGAAAGCCAGCGGCCACGATACGTGTTGATTGAAGGCCCGGCTGATTTT
AATGACCGGGTAGACGAACTGTTTTTAGCCCACCAGCTTCCGGTAGCTATTTACAGTTAT
TGCCAGTATCAGGACGGTGCAGCCCCCGGGCGTGGTGCCTGGACGCCATTTGCTGAATTT
TCGCCGGAGTGGCAGGCGCTACAAGCCGCACGTCGCATTCAGGCACAAACTTACTTCATC
GATTTGCCTTGCTGGGCGCAGAGTGAAGAAGAGGACGATTCGCCTGATACGCAAGATGAA
AGCCAGGCCTTACTGCTGCGTGCCACCCGCATGGATAACAGCGATACCCTGTGGGATCAC
TTGTTCGAAGATGAAAGCCAGCAAACTGCATTACCCTCTGCGCTGGCGCACTATTTTGCC
CAACTGCGGGGCGACGCCTCCGGCGATGCGCTCAATCGTCAGCGCGAAGCCTTTATGGCC
CGCTGGATTGGATGGGCGATGCAGCAAAATAATGGCGACGTGTTAGTTGTCTGCGGTGGC
TGGCACGCTCCGGCACTGGCAAAGATGTGGCGCGAATGCCCTCAGAAAATTAACAAGCCA
GAATTGCCCTCGCTGGCAGATGCCGTTACAGGTTGTTATCTCACACCCTACAGTGAAAAG
CGCCTTGATGTGCTGGCAGGATACCTTTCAGGAATGCCTGCCCCGGTATGGCAAAACTGG
TGCTGGCAGTGGGGCTTGCAGAAGGCCGGTGAACAACTGCTAAAAACTATCCTTACCCGT
TTGCGCCAGCACAAATTGCCCGCTTCTACCGCGGATATGGCTGCCGCTCATCTGCATGCG
ATGGCGCTGGCACAGTTGCGCGGTCATACACTACCGTTACGCACTGACTGGCTGGATGCC
ATAGCAGGCTCGCTGATTAAAGAAGCCCTGAACGCGCCGTTGCCGTGGAGCTATCGCGGC
GTTATTCATCCCGATACCGATCCGATTCTGCTAACGTTGATAGACACATTAGCGGGTGAC
GGATTCGGTAAACTTGCCCCTTCTACGCCACAACCGCCTCTGCCAAAAGATGTCACCTGC
GAACTGGAACGTACCGCAATCTCCCTTCCGGCGGAGCTTACCTTAAATCGCTTTACCCCC
GATGGGCTGGCGCAAAGTCAGGTGTTACATCGGCTGGCAATACTGGAGATCCCTGGGATT
GTACGCCAGCAGGGAAGTACACTGACACTTGCAGGCAACGGTGAAGAACGCTGGAAATTA
ACCCGCCCGCTTAGCCAGCATGCGGCATTGATTGAGGCCGCCTGTTTTGGTGCCACACTC
CAGGAAGCCGCACGCAATAAATTAGAAGCCGATATGCTGGACGCGGGCGGAATCGGCAGT
ATCACCACATGTCTTAGCCAGGCGGCGTTAGCGGGTCTGGCGTCCTTCAGTCAACAATTA
CTGGAGCAACTCACACTATTAATCGCCCAGGAAAATCAATTTGCCGAAATGGGCCAGGCG
CTGGAAGTGCTTTATGCCTTATGGCGGCTGGATGAAATTAGCGGTATGCAAGGCGCGCAG
ATATTACAAACGACGTTATGCGCGACTATCGATCGCACGCTGTGGCTGTGTGAATCTAAC
GGCAGACCGGATGAAAAGGAGTTTCACGCTCACCTGCATAGCTGGCAAGCGCTTTGCCAT
ATTCTGCGCGATCTACATAGCGGCGTTAATTTACCCGGCGTTTCTCTTTCTGCGGCGGTA
GCCTTACTGGAGCGACGCAGTCAGGCAATTCATGCCCCGGCGCTGGATCGCGGCGCGGCT
CTTGGCGCACTAATGCGTCTGGAACATCCCAACGCCAGTGCCGAAGCGGCGCTGACGATG
CTGGCGCAGTTATCCCCGGCACAATCTGGTGAGGCGCTGCACGGTTTGCTGGCGCTGGCC
CGCCATCAACTGGCCTGTCAGCCGGCATTTATCGCCGGTTTCAGCAGTCATTTAAATCAA
CTGAGTGAAGCCGATTTTATTAACGCCCTGCCCGATTTACGCGCGGCGATGGCCTGGCTA
CCACCACGAGAACGCGGGACGCTGGCGCATCAGGTGCTTGAGCATTATCAACTGGCGCAA
CTTCCCGTTTCGGCGCTGCAAATGCCGTTGCATTGTCCACCACAGGCCATTGCACATCAT
CAACAACTCGAACAGCAGGCACTGGCATCGCTGCAAAACTGGGGAGTTTTCCATGTCTGA
Protein Properties
Pfam Domain Function:
Protein Residues:759
Protein Molecular Weight:82417
Protein Theoretical pI:5
Signaling Regions:
  • None
Transmembrane Regions:
  • None
Protein Sequence:
>NADP-dependent malic enzyme
MDDQLKQSALDFHEFPVPGKIQVSPTKPLATQRDLALAYSPGVAAPCLEIEKDPLKAYKY
TARGNLVAVISNGTAVLGLGNIGALAGKPVMEGKGVLFKKFAGIDVFDIEVDELDPDKFI
EVVAALEPTFGGINLEDIKAPECFYIEQKLRERMNIPVFHDDQHGTAIISTAAILNGLRV
VEKNISDVRMVVSGAGAAAIACMNLLVALGLQKHNIVVCDSKGVIYQGREPNMAETKAAY
AVVDDGKRTLDDVIEGADIFLGCSGPKVLTQEMVKKMARAPMILALANPEPEILPPLAKE
VRPDAIICTGRSDYPNQVNNVLCFPFIFRGALDVGATAINEEMKLAAVRAIAELAHAEQS
EVVASAYGDQDLSFGPEYIIPKPFDPRLIVKIAPAVAKAAMESGVATRPIADFDVYIDKL
TEFVYKTNLFMKPIFSQARKAPKRVVLPEGEEARVLHATQELVTLGLAKPILIGRPNVIE
MRIQKLGLQIKAGVDFEIVNNESDPRFKEYWTEYFQIMKRRGVTQEQAQRALISNPTVIG
AIMVQRGEADAMICGTVGDYHEHFSVVKNVFGYRDGVHTAGAMNALLLPSGNTFIADTYV
NDEPDAEELAEITLMAAETVRRFGIEPRVALLSHSNFGSSDCPSSSKMRQALELVRERAP
ELMIDGEMHGDAALVEAIRNDRMPDSSLKGSANILVMPNMEAARISYNLLRVSSSEGVTV
GPVLMGVAKPVHVLTPIASVRRIVNMVALAVVEAQTQPL
References
External Links:
ResourceLink
Uniprot ID:P76558
Uniprot Name:MAO2_ECOLI
GenBank Gene ID:AP009048
Genebank Protein ID:85675233
Ecogene ID:EG14193
Ecocyc:EG14193
ColiBase:b2463
Kegg Gene:b2463
EchoBASE ID:EB3945
CCDB:MAO2_ECOLI
BacMap:16130388
General Reference:
  • Blattner, F. R., Plunkett, G. 3rd, Bloch, C. A., Perna, N. T., Burland, V., Riley, M., Collado-Vides, J., Glasner, J. D., Rode, C. K., Mayhew, G. F., Gregor, J., Davis, N. W., Kirkpatrick, H. A., Goeden, M. A., Rose, D. J., Mau, B., Shao, Y. (1997). "The complete genome sequence of Escherichia coli K-12." Science 277:1453-1462. Pubmed: 9278503
  • Hayashi, K., Morooka, N., Yamamoto, Y., Fujita, K., Isono, K., Choi, S., Ohtsubo, E., Baba, T., Wanner, B. L., Mori, H., Horiuchi, T. (2006). "Highly accurate genome sequences of Escherichia coli K-12 strains MG1655 and W3110." Mol Syst Biol 2:2006.0007. Pubmed: 16738553
  • Iwakura, M., Hattori, J., Arita, Y., Tokushige, M., Katsuki, H. (1979). "Studies on regulatory functions of malic enzymes. VI. Purification and molecular properties of NADP-linked malic enzyme from Escherichia coli W." J Biochem 85:1355-1365. Pubmed: 36376
  • Yamamoto, Y., Aiba, H., Baba, T., Hayashi, K., Inada, T., Isono, K., Itoh, T., Kimura, S., Kitagawa, M., Makino, K., Miki, T., Mitsuhashi, N., Mizobuchi, K., Mori, H., Nakade, S., Nakamura, Y., Nashimoto, H., Oshima, T., Oyama, S., Saito, N., Sampei, G., Satoh, Y., Sivasundaram, S., Tagami, H., Horiuchi, T., et, a. l. .. (1997). "Construction of a contiguous 874-kb sequence of the Escherichia coli -K12 genome corresponding to 50.0-68.8 min on the linkage map and analysis of its sequence features." DNA Res 4:91-113. Pubmed: 9205837
  • Zhang, J., Sprung, R., Pei, J., Tan, X., Kim, S., Zhu, H., Liu, C. F., Grishin, N. V., Zhao, Y. (2009). "Lysine acetylation is a highly abundant and evolutionarily conserved modification in Escherichia coli." Mol Cell Proteomics 8:215-225. Pubmed: 18723842