Identification
Name:Oxygen sensor protein DosP
Synonyms:
  • Direct oxygen sensing phosphodiesterase
  • Direct oxygen sensor protein
  • Ec DOS
  • Heme-regulated cyclic di-GMP phosphodiesterase,
Gene Name:dosP
Enzyme Class:
Biological Properties
General Function:Involved in phosphorus-oxygen lyase activity
Specific Function:In association with DosC is involved in the production and removal of the second messenger c-di-GMP in response to changing O(2) levels. Has phosphodiesterase (PDE) activity with c- di-GMP (PubMed:15995192), very poor activity on cAMP (PubMed:15995192) but not with cGMP, bis(p-nitrophenyl) phosphate or p-nitrophenyl phosphate (PubMed:11970957). Cyclic-di-GMP is a second messenger which controls cell surface-associated traits in bacteria
Cellular Location:Not Available
SMPDB Pathways:Not Available
KEGG Pathways:Not Available
KEGG Reactions:
3',5'-Cyclic diGMP+Thumb+ThumbThumb
EcoCyc Reactions:
Thumb+ThumbThumb+Thumb
Complex Reactions:
Thumb+ThumbThumb+Thumb
Metabolites:
ECMDB IDNameView
ECMDB00045Adenosine monophosphateMetaboCard
ECMDB00058Cyclic AMPMetaboCard
ECMDB23177Cyclic di-3',5'-guanylateMetaboCard
ECMDB04034Cyclic GMPMetaboCard
ECMDB01397Guanosine monophosphateMetaboCard
ECMDB21225Hydrogen ionMetaboCard
ECMDB20579Linear dimeric GMPMetaboCard
ECMDB00494WaterMetaboCard
GO Classification:
Function
catalytic activity
kinase activity
molecular transducer activity
protein histidine kinase activity
protein kinase activity
signal transducer activity
transferase activity
transferase activity, transferring phosphorus-containing groups
two-component sensor activity
Process
biological regulation
regulation of biological process
regulation of cellular process
regulation of gene expression
regulation of macromolecule metabolic process
regulation of metabolic process
regulation of transcription
regulation of transcription, DNA-dependent
signal transduction
signal transmission
signaling process
two-component signal transduction system (phosphorelay)
Gene Properties
Blattner:b1489
Gene OrientationCounterclockwise
Centisome Percentage:33.65
Left Sequence End1561358
Right Sequence End1563757
Gene Sequence:
>2400 bp
ATGAAGCTAACCGATGCGGATAATGCCGCCGATGGCATTTTTTTCCCCGCCCTTGAGCAA
AATATGATGGGTGCGGTGTTAATTAACGAAAATGATGAAGTGATGTTTTTCAACCCCGCC
GCAGAGAAGCTCTGGGGATACAAACGTGAAGAAGTCATTGGCAATAACATTGATATGCTG
ATTCCGCGGGATTTGCGTCCTGCGCATCCTGAATACATTCGTCACAACCGTGAAGGCGGT
AAAGCGCGTGTTGAGGGGATGAGTCGGGAGCTGCAGCTGGAGAAAAAAGACGGCAGTAAA
ATCTGGACCCGTTTTGCGCTATCGAAAGTGAGCGCCGAGGGGAAAGTTTATTACCTGGCG
CTGGTACGGGATGCCAGCGTAGAAATGGCGCAAAAAGAACAGACCCGACAATTGATTATT
GCCGTTGACCATCTCGACCGACCGGTGATTGTCCTCGATCCGGAACGCCATATTGTGCAG
TGCAATCGCGCATTTACCGAAATGTTTGGTTACTGCATTAGCGAAGCCAGCGGTATGCAG
CCCGATACACTCCTGAACATTCCTGAATTCCCTGCCGATAACCGCATTCGTTTACAACAG
TTGCTATGGAAAACCGCCCGCGATCAGGACGAATTTCTGCTGTTGACGCGCACCGGTGAA
AAAATCTGGATTAAAGCCTCTATCAGCCCGGTTTATGACGTGCTCGCGCATCTGCAGAAC
CTGGTAATGACTTTCTCGGATATCACCGAAGAACGGCAGATTCGCCAGCTTGAAGGCAAT
ATTCTCGCCGCCATGTGCAGCAGCCCGCCATTTCATGAAATGGGGGAAATCATTTGTCGT
AACATCGAATCTGTACTCAACGAATCGCATGTTTCGCTGTTCGCACTGCGCAACGGGATG
CCGATACACTGGGCGTCATCTTCCCACGGTGCAGAAATTCAAAATGCGCAAAGCTGGTCA
GCGACCATTCGTCAGCGTGATGGCGCGCCTGCGGGGATCCTGCAAATTAAAACCTCGTCA
GGAGCAGAAACCAGCGCCTTTATCGAACGCGTGGCAGATATCAGCCAGCATATGGCCGCG
CTGGCGCTGGAACAGGAAAAAAGCCGTCAGCATATTGAACAACTCATCCAATTTGATCCG
ATGACCGGTCTGCCAAATCGCAATAACCTGCACAATTACCTCGATGACCTGGTCGACAAA
GCCGTCTCTCCCGTGGTGTATCTCATCGGTGTTGACCATATTCAGGATGTGATTGATAGC
CTTGGCTATGCGTGGGCCGATCAGGCATTGCTGGAAGTGGTCAATCGCTTTCGTGAAAAA
CTCAAACCGGATCAGTATCTCTGTCGTATCGAAGGTACGCAGTTTGTCCTCGTGAGCCTC
GAAAACGACGTCAGTAACATTACCCAAATCGCCGATGAGCTACGGAATGTGGTCAGCAAG
CCGATAATGATTGACGATAAACCCTTCCCGCTTACCTTGAGTATTGGCATCAGCTACGAC
CTGGGTAAAAACCGCGATTACTTGCTCTCCACTGCTCACAATGCAATGGATTATATTCGC
AAGAATGGCGGTAACGGCTGGCAGTTCTTCAGCCCGGCGATGAACGAAATGGTAAAAGAG
CGTTTGGTTTTAGGCGCAGCGCTGAAAGAAGCGATTAGCAATAACCAACTGAAACTGGTT
TACCAGCCGCAAATCTTCGCAGAAACGGGTGAACTGTACGGCATCGAAGCCCTTGCTCGC
TGGCACGATCCCCTGCATGGTCATGTGCCCCCTTCACGGTTTATTCCTCTCGCAGAAGAG
ATTGGTGAAATCGAAAATATTGGGCGCTGGGTCATCGCGGAAGCTTGCCGTCAGTTAGCA
GAATGGCGTAGCCAGAATATTCATATCCCGGCGTTATCCGTGAACTTGTCGGCGCTGCAC
TTTCGCAGTAATCAACTGCCTAATCAGGTGTCTGATGCAATGCACGCCTGGGGTATTGAC
GGCCACCAGCTGACGGTAGAAATCACGGAAAGCATGATGATGGAACACGATACCGAAATC
TTTAAGCGCATTCAGATCCTGCGTGATATGGGCGTGGGCTTATCGGTAGATGATTTTGGT
ACGGGCTTTTCCGGATTATCCCGCTTAGTCAGTCTTCCGGTAACGGAAATCAAAATTGAC
AAAAGTTTTGTCGATCGTTGTCTGACCGAAAAACGCATCCTTGCCTTACTTGAAGCCATT
ACCAGCATTGGGCAAAGCCTCAATTTAACCGTCGTGGCGGAAGGCGTCGAAACCAAAGAG
CAATTTGAGATGCTACGCAAGATCCACTGTCGCGTTATTCAGGGATATTTCTTTTCCCGC
CCCCTACCCGCCGAAGAAATTCCAGGCTGGATGAGCAGCGTGTTACCGCTGAAAATCTGA
Protein Properties
Pfam Domain Function:
Protein Residues:799
Protein Molecular Weight:90260
Protein Theoretical pI:5
PDB File:1VB6
Signaling Regions:
  • None
Transmembrane Regions:
  • None
Protein Sequence:
>Oxygen sensor protein DosP
MKLTDADNAADGIFFPALEQNMMGAVLINENDEVMFFNPAAEKLWGYKREEVIGNNIDML
IPRDLRPAHPEYIRHNREGGKARVEGMSRELQLEKKDGSKIWTRFALSKVSAEGKVYYLA
LVRDASVEMAQKEQTRQLIIAVDHLDRPVIVLDPERHIVQCNRAFTEMFGYCISEASGMQ
PDTLLNIPEFPADNRIRLQQLLWKTARDQDEFLLLTRTGEKIWIKASISPVYDVLAHLQN
LVMTFSDITEERQIRQLEGNILAAMCSSPPFHEMGEIICRNIESVLNESHVSLFALRNGM
PIHWASSSHGAEIQNAQSWSATIRQRDGAPAGILQIKTSSGAETSAFIERVADISQHMAA
LALEQEKSRQHIEQLIQFDPMTGLPNRNNLHNYLDDLVDKAVSPVVYLIGVDHIQDVIDS
LGYAWADQALLEVVNRFREKLKPDQYLCRIEGTQFVLVSLENDVSNITQIADELRNVVSK
PIMIDDKPFPLTLSIGISYDLGKNRDYLLSTAHNAMDYIRKNGGNGWQFFSPAMNEMVKE
RLVLGAALKEAISNNQLKLVYQPQIFAETGELYGIEALARWHDPLHGHVPPSRFIPLAEE
IGEIENIGRWVIAEACRQLAEWRSQNIHIPALSVNLSALHFRSNQLPNQVSDAMHAWGID
GHQLTVEITESMMMEHDTEIFKRIQILRDMGVGLSVDDFGTGFSGLSRLVSLPVTEIKID
KSFVDRCLTEKRILALLEAITSIGQSLNLTVVAEGVETKEQFEMLRKIHCRVIQGYFFSR
PLPAEEIPGWMSSVLPLKI
References
External Links:
ResourceLink
Uniprot ID:P76129
Uniprot Name:DOSP_ECOLI
GenBank Gene ID:AP009048
Genebank Protein ID:1742440
PDB ID:1VB6
Ecogene ID:EG13792
Ecocyc:EG13792
ColiBase:b1489
Kegg Gene:b1489
EchoBASE ID:EB3553
CCDB:DOSP_ECOLI
BacMap:162135902
General Reference:
  • Aiba, H., Baba, T., Hayashi, K., Inada, T., Isono, K., Itoh, T., Kasai, H., Kashimoto, K., Kimura, S., Kitakawa, M., Kitagawa, M., Makino, K., Miki, T., Mizobuchi, K., Mori, H., Mori, T., Motomura, K., Nakade, S., Nakamura, Y., Nashimoto, H., Nishio, Y., Oshima, T., Saito, N., Sampei, G., Horiuchi, T., et, a. l. .. (1996). "A 570-kb DNA sequence of the Escherichia coli K-12 genome corresponding to the 28.0-40.1 min region on the linkage map." DNA Res 3:363-377. Pubmed: 9097039
  • Blattner, F. R., Plunkett, G. 3rd, Bloch, C. A., Perna, N. T., Burland, V., Riley, M., Collado-Vides, J., Glasner, J. D., Rode, C. K., Mayhew, G. F., Gregor, J., Davis, N. W., Kirkpatrick, H. A., Goeden, M. A., Rose, D. J., Mau, B., Shao, Y. (1997). "The complete genome sequence of Escherichia coli K-12." Science 277:1453-1462. Pubmed: 9278503
  • Delgado-Nixon, V. M., Gonzalez, G., Gilles-Gonzalez, M. A. (2000). "Dos, a heme-binding PAS protein from Escherichia coli, is a direct oxygen sensor." Biochemistry 39:2685-2691. Pubmed: 10704219
  • Gonzalez, G., Dioum, E. M., Bertolucci, C. M., Tomita, T., Ikeda-Saito, M., Cheesman, M. R., Watmough, N. J., Gilles-Gonzalez, M. A. (2002). "Nature of the displaceable heme-axial residue in the EcDos protein, a heme-based sensor from Escherichia coli." Biochemistry 41:8414-8421. Pubmed: 12081490
  • Hayashi, K., Morooka, N., Yamamoto, Y., Fujita, K., Isono, K., Choi, S., Ohtsubo, E., Baba, T., Wanner, B. L., Mori, H., Horiuchi, T. (2006). "Highly accurate genome sequences of Escherichia coli K-12 strains MG1655 and W3110." Mol Syst Biol 2:2006.0007. Pubmed: 16738553
  • Kurokawa, H., Lee, D. S., Watanabe, M., Sagami, I., Mikami, B., Raman, C. S., Shimizu, T. (2004). "A redox-controlled molecular switch revealed by the crystal structure of a bacterial heme PAS sensor." J Biol Chem 279:20186-20193. Pubmed: 14982921
  • Lechauve, C., Bouzhir-Sima, L., Yamashita, T., Marden, M. C., Vos, M. H., Liebl, U., Kiger, L. (2009). "Heme ligand binding properties and intradimer interactions in the full-length sensor protein dos from Escherichia coli and its isolated heme domain." J Biol Chem 284:36146-36159. Pubmed: 19864414
  • Liebl, U., Bouzhir-Sima, L., Kiger, L., Marden, M. C., Lambry, J. C., Negrerie, M., Vos, M. H. (2003). "Ligand binding dynamics to the heme domain of the oxygen sensor Dos from Escherichia coli." Biochemistry 42:6527-6535. Pubmed: 12767236
  • Mendez-Ortiz, M. M., Hyodo, M., Hayakawa, Y., Membrillo-Hernandez, J. (2006). "Genome-wide transcriptional profile of Escherichia coli in response to high levels of the second messenger 3',5'-cyclic diguanylic acid." J Biol Chem 281:8090-8099. Pubmed: 16418169
  • Park, H., Suquet, C., Satterlee, J. D., Kang, C. (2004). "Insights into signal transduction involving PAS domain oxygen-sensing heme proteins from the X-ray crystal structure of Escherichia coli Dos heme domain (Ec DosH)." Biochemistry 43:2738-2746. Pubmed: 15005609
  • Park, H., Suquet, C., Savenkova, M. I., Satterlee, J. D., Kang, C. (2002). "Cloning, purification, crystallization and preliminary X-ray analysis of DOS heme domain, a new heme oxygen sensor in Escherichia coli." Acta Crystallogr D Biol Crystallogr 58:1504-1506. Pubmed: 12198316
  • Sasakura, Y., Hirata, S., Sugiyama, S., Suzuki, S., Taguchi, S., Watanabe, M., Matsui, T., Sagami, I., Shimizu, T. (2002). "Characterization of a direct oxygen sensor heme protein from Escherichia coli. Effects of the heme redox states and mutations at the heme-binding site on catalysis and structure." J Biol Chem 277:23821-23827. Pubmed: 11970957
  • Sato, A., Sasakura, Y., Sugiyama, S., Sagami, I., Shimizu, T., Mizutani, Y., Kitagawa, T. (2002). "Stationary and time-resolved resonance Raman spectra of His77 and Met95 mutants of the isolated heme domain of a direct oxygen sensor from Escherichia coli." J Biol Chem 277:32650-32658. Pubmed: 12080073
  • Schmidt, A. J., Ryjenkov, D. A., Gomelsky, M. (2005). "The ubiquitous protein domain EAL is a cyclic diguanylate-specific phosphodiesterase: enzymatically active and inactive EAL domains." J Bacteriol 187:4774-4781. Pubmed: 15995192
  • Sommerfeldt, N., Possling, A., Becker, G., Pesavento, C., Tschowri, N., Hengge, R. (2009). "Gene expression patterns and differential input into curli fimbriae regulation of all GGDEF/EAL domain proteins in Escherichia coli." Microbiology 155:1318-1331. Pubmed: 19332833
  • Tanaka, A., Takahashi, H., Shimizu, T. (2007). "Critical role of the heme axial ligand, Met95, in locking catalysis of the phosphodiesterase from Escherichia coli (Ec DOS) toward Cyclic diGMP." J Biol Chem 282:21301-21307. Pubmed: 17535805
  • Tuckerman, J. R., Gonzalez, G., Sousa, E. H., Wan, X., Saito, J. A., Alam, M., Gilles-Gonzalez, M. A. (2009). "An oxygen-sensing diguanylate cyclase and phosphodiesterase couple for c-di-GMP control." Biochemistry 48:9764-9774. Pubmed: 19764732
  • Yokota, N., Araki, Y., Kurokawa, H., Ito, O., Igarashi, J., Shimizu, T. (2006). "Critical roles of Leu99 and Leu115 at the heme distal side in auto-oxidation and the redox potential of a heme-regulated phosphodiesterase from Escherichia coli." FEBS J 273:1210-1223. Pubmed: 16519686
  • Yoshimura, T., Sagami, I., Sasakura, Y., Shimizu, T. (2003). "Relationships between heme incorporation, tetramer formation, and catalysis of a heme-regulated phosphodiesterase from Escherichia coli: a study of deletion and site-directed mutants." J Biol Chem 278:53105-53111. Pubmed: 14551206