Identification
Name:Putative formate acetyltransferase 3
Synonyms:
  • Pyruvate formate-lyase 3
Gene Name:ybiW
Enzyme Class:
Biological Properties
General Function:Involved in catalytic activity
Specific Function:Acetyl-CoA + formate = CoA + pyruvate
Cellular Location:Cytoplasm
SMPDB Pathways:
KEGG Pathways:
KEGG Reactions:
Thumb+ThumbThumb+Thumb
Thumb+ThumbThumb+Thumb
Thumb+ThumbThumb+Thumb
Thumb+ThumbThumb+Thumb
EcoCyc Reactions:
Thumb+ThumbThumb+Thumb
Thumb+ThumbThumb+Thumb
Metabolites:
ECMDB IDNameView
ECMDB000052-Ketobutyric acidMetaboCard
ECMDB01206Acetyl-CoAMetaboCard
ECMDB01423Coenzyme AMetaboCard
ECMDB00142Formic acidMetaboCard
ECMDB01275Propionyl-CoAMetaboCard
ECMDB00243Pyruvic acidMetaboCard
GO Classification:
Component
cell part
cytoplasm
intracellular part
Function
acetyltransferase activity
acyltransferase activity
C-acetyltransferase activity
catalytic activity
formate C-acetyltransferase activity
transferase activity
transferase activity, transferring acyl groups
transferase activity, transferring acyl groups other than amino-acyl groups
Process
alcohol metabolic process
glucose metabolic process
hexose metabolic process
metabolic process
monosaccharide metabolic process
small molecule metabolic process
Gene Properties
Blattner:b0823
Gene OrientationCounterclockwise
Centisome Percentage:18.52
Left Sequence End859397
Right Sequence End861829
Gene Sequence:
>2433 bp
ATGGCGATGAAAAAGTTGCTCATAGCGTCGCTGCTGTTTAGCAGCGCCACCGTATACGGT
GCTGAAGGGTTCGTAGTGAAAGATATTCATTTCGAAGGCCTTCAGCGTGTCGCCGTTGGT
GCGGCCCTCCTCAGTATGCCGGTGCGCACAGGCGACACGGTTAATGATGAAGATATCAGT
AATACCATTCGCGCTCTGTTTGCTACCGGCAACTTTGAGGATGTTCGCGTCCTTCGTGAT
GGTGATACCCTTCTGGTTCAGGTAAAAGAACGTCCGACCATTGCCAGCATTACTTTCTCC
GGTAACAAATCGGTGAAAGATGACATGCTGAAGCAAAACCTCGAGGCTTCTGGTGTGCGT
GTGGGCGAATCCCTCGATCGCACCACCATTGCCGATATCGAGAAAGGTCTGGAAGACTTC
TACTACAGCGTCGGTAAATATAGCGCCAGCGTAAAAGCTGTCGTGACCCCGCTGCCGCGC
AACCGTGTTGACCTAAAACTGGTGTTCCAGGAAGGTGTGTCAGCTGAAATCCAGCAAATT
AACATTGTTGGTAACCATGCTTTCACCACCGACGAACTGATCTCTCATTTCCAACTGCGT
GACGAAGTGCCGTGGTGGAACGTGGTAGGCGATCGTAAATACCAGAAACAGAAACTGGCG
GGCGACCTTGAAACCCTGCGCAGCTACTATCTGGATCGCGGTTATGCCCGTTTCAACATC
GACTCTACCCAGGTCAGTCTGACGCCAGATAAAAAAGGTATTTACGTCACGGTGAACATC
ACCGAAGGCGATCAGTACAAGCTTTCTGGCGTTGAAGTGAGCGGCAACCTTGCCGGGCAC
TCCGCTGAAATTGAGCAGCTGACTAAGATCGAGCCGGGTGAGCTGTATAACGGCACCAAA
GTGACCAAGATGGAAGATGACATCAAAAAGCTTCTCGGTCGCTATGGTTATGCCTATCCG
CGCGTACAGTCGATGCCCGAAATTAACGATGCCGACAAAACCGTTAAATTACGTGTGAAC
GTTGATGCGGGTAACCGTTTCTACGTGCGTAAGATCCGTTTTGAAGGTAACGATACCTCG
AAAGATGCCGTCCTGCGTCGCGAAATGCGTCAGATGGAAGGTGCATGGCTGGGGAGCGAT
CTGGTCGATCAGGGTAAGGAGCGTCTGAATCGTCTGGGCTTCTTTGAAACTGTCGATACC
GATACCCAACGTGTTCCGGGTAGCCCGGACCAGGTTGATGTCGTCTACAAGGTAAAAGAG
CGCAACACCGGTAGCTTCAACTTTGGTATTGGTTACGGTACTGAAAGTGGCGTGAGCTTC
CAGGCTGGTGTGCAGCAGGATAACTGGTTAGGTACAGGTTATGCTGTTGGTATCAACGGG
ACCAAAAACGATTACCAGACCTATGCTGAACTGTCGGTAACCAACCCGTACTTCACCGTA
GATGGCGTAAGCCTCGGTGGTCGTCTCTTCTATAATGACTTCCAGGCAGATGACGCCGAC
CTGTCCGACTATACCAACAAGAGTTATGGTACAGACGTGACGTTGGGCTTCCCGATTAAC
GAATATAACTCGCTGCGTGCAGGTCTGGGTTATGTACATAACTCCCTGTCCAACATGCAG
CCTCAGGTTGCGATGTGGCGTTATCTGTACTCTATGGGTGAACATCCGAGCACCTCTGAT
CAGGATAACAGCTTCAAAACGGACGACTTCACGTTCAACTATGGTTGGACCTATAACAAG
CTTGACCGTGGTTACTTCCCGACAGATGGTTCACGTGTCAACCTGACCGGTAAAGTGACC
ATTCCTGGATCGGATAACGAATACTACAAAGTGACGTTAGACACGGCGACTTATGTGCCG
ATCGATGACGATCACAAATGGGTTGTTCTGGGGCGTACCCGCTGGGGTTATGGTGATGGT
TTAGGCGGCAAAGAGATGCCGTTCTACGAGAACTTCTATGCCGGTGGTTCCAGCACCGTG
CGTGGCTTCCAGTCCAATACCATTGGTCCGAAAGCAGTTTACTTCCCGCATCAGGCCAGT
AATTATGATCCGGACTATGATTACGAATGTGCGACTCAGGACGGCGCGAAAGACCTGTGT
AAATCGGATGATGCTGTAGGCGGTAACGCCATGGCGGTTGCCAGCCTCGAGTTCATCACC
CCGACGCCGTTTATTAGCGATAAGTATGCTAACTCGGTTCGTACTTCCTTCTTCTGGGAT
ATGGGTACCGTTTGGGATACAAACTGGGATTCCAGCCAATATTCTGGATATCCGGACTAT
AGTGATCCAAGCAATATCCGTATGTCTGCGGGTATCGCATTACAATGGATGTCCCCATTG
GGGCCGTTGGTGTTCTCCTACGCCCAGCCGTTCAAAAAGTACGATGGAGACAAGGCAGAA
CAGTTCCAGTTTAACATCGGTAAAACCTGGTAA
Protein Properties
Pfam Domain Function:
Protein Residues:810
Protein Molecular Weight:90125
Protein Theoretical pI:6
Signaling Regions:
  • None
Transmembrane Regions:
  • None
Protein Sequence:
>Putative formate acetyltransferase 3
MTTLKLDTLSDRIKAHKNALVHIVKPPVCTERAQHYTEMYQQHLDKPIPVRRALALAHHL
ANRTIWIKHDELIIGNQASEVRAAPIFPEYTVSWIEKEIDDLADRPGAGFAVSEENKRVL
HEVCPWWRGQTVQDRCYGMFTDEQKGLLATGIIKAEGNMTSGDAHLAVNFPLLLEKGLDG
LREEVAERRSRINLTVLEDLHGEQFLKAIDIVLVAVSEHIERFAALAREMAATETRESRR
DELLAMAENCDLIAHQPPQTFWQALQLCYFIQLILQIESNGHSVSFGRMDQYLYPYYRRD
VELNQTLDREHAIEMLHSCWLKLLEVNKIRSGSHSKASAGSPLYQNVTIGGQNLVDGQPM
DAVNPLSYAILESCGRLRSTQPNLSVRYHAGMSNDFLDACVQVIRCGFGMPAFNNDEIVI
PEFIKLGIEPQDAYDYAAIGCIETAVGGKWGYRCTGMSFINFARVMLAALEGGHDATSGK
VFLPQEKALSAGNFNNFDEVMDAWDTQIRYYTRKSIEIEYVVDTMLEENVHDILCSALVD
DCIERAKSIKQGGAKYDWVSGLQVGIANLGNSLAAVKKLVFEQGAIGQQQLAAALADDFD
GLTHEQLRQRLINGAPKYGNDDDTVDTLLARAYQTYIDELKQYHNPRYGRGPVGGNYYAG
TSSISANVPFGAQTMATPDGRKAHTPLAEGASPASGTDHLGPTAVIGSVGKLPTAAILGG
VLLNQKLNPATLENESDKQKLMILLRTFFEVHKGWHIQYNIVSRETLLDAKKHPDQYRDL
VVRVAGYSAFFTALSPDAQDDIIARTEHML
References
External Links:
ResourceLink
Uniprot ID:P75793
Uniprot Name:PFLF_ECOLI
GenBank Gene ID:AP009048
Genebank Protein ID:85674369
Ecogene ID:EG13328
Ecocyc:EG13328
ColiBase:b0823
Kegg Gene:b0823
EchoBASE ID:EB3112
CCDB:PFLF_ECOLI
BacMap:16128791
General Reference:
  • Blattner, F. R., Plunkett, G. 3rd, Bloch, C. A., Perna, N. T., Burland, V., Riley, M., Collado-Vides, J., Glasner, J. D., Rode, C. K., Mayhew, G. F., Gregor, J., Davis, N. W., Kirkpatrick, H. A., Goeden, M. A., Rose, D. J., Mau, B., Shao, Y. (1997). "The complete genome sequence of Escherichia coli K-12." Science 277:1453-1462. Pubmed: 9278503
  • Hayashi, K., Morooka, N., Yamamoto, Y., Fujita, K., Isono, K., Choi, S., Ohtsubo, E., Baba, T., Wanner, B. L., Mori, H., Horiuchi, T. (2006). "Highly accurate genome sequences of Escherichia coli K-12 strains MG1655 and W3110." Mol Syst Biol 2:2006.0007. Pubmed: 16738553
  • Oshima, T., Aiba, H., Baba, T., Fujita, K., Hayashi, K., Honjo, A., Ikemoto, K., Inada, T., Itoh, T., Kajihara, M., Kanai, K., Kashimoto, K., Kimura, S., Kitagawa, M., Makino, K., Masuda, S., Miki, T., Mizobuchi, K., Mori, H., Motomura, K., Nakamura, Y., Nashimoto, H., Nishio, Y., Saito, N., Horiuchi, T., et, a. l. .. (1996). "A 718-kb DNA sequence of the Escherichia coli K-12 genome corresponding to the 12.7-28.0 min region on the linkage map." DNA Res 3:137-155. Pubmed: 8905232