Identification
Name:Uncharacterized protein ybhJ
Synonyms:Not Available
Gene Name:ybhJ
Enzyme Class:
Biological Properties
General Function:Involved in metabolic process
Specific Function:Unknown Function
Cellular Location:Not Available
SMPDB Pathways:
  • Secondary Metabolites: Glyoxylate cycle PW000967
  • glycolate and glyoxylate degradation II PW002021
KEGG Pathways:
  • Citrate cycle (TCA cycle) ec00020
  • Glyoxylate and dicarboxylate metabolism ec00630
  • Metabolic pathways eco01100
  • Microbial metabolism in diverse environments ec01120
  • Reductive carboxylate cycle (CO2 fixation) ec00720
KEGG Reactions:
Thumb+ThumbThumb
ThumbThumb+Thumb
ThumbThumb
ThumbThumb+Thumb
ThumbThumb+Thumb
Thumb+Thumb+ThumbThumb
SMPDB Reactions:
Thumb+ThumbThumb
Thumb+ThumbThumb
EcoCyc Reactions:
Thumb+ThumbThumb
ThumbThumb+Thumb
Metabolites:
ECMDB IDNameView
ECMDB00072cis-Aconitic acidMetaboCard
ECMDB00094Citric acidMetaboCard
ECMDB04088Isocitric acidMetaboCard
ECMDB00494WaterMetaboCard
GO Classification:
Process
metabolic process
Gene Properties
Blattner:b0771
Gene OrientationClockwise
Centisome Percentage:17.30
Left Sequence End802726
Right Sequence End804987
Gene Sequence:
>2262 bp
ATGATCAAGTTATCTGAAAAAGGCGTGTTTCTCGCCAGTAATAACGAAATAATTGCCGAA
GAACATTTCACCGGCGAAATTAAAAAAGAAGAAGCCAAAAAAGGCACTATTGCCTGGTCT
ATTCTCTCTTCGCATAATACGTCCGGAAATATGGATAAACTTAAAATTAAGTTTGATTCA
TTAGCCTCTCACGATATTACCTTTGTTGGTATTGTACAGACCGCTAAAGCGTCCGGTATG
GAACGTTTCCCGCTGCCGTATGTGCTGACCAACTGCCATAACTCACTCTGCGCCGTCGGC
GGCACTATTAACGGTGATGACCATGTTTTTGGTTTATCGGCGGCCCAGCGTTATGGCGGT
ATTTTTGTGCCTCCGCATATTGCGGTCATCCATCAATATATGCGTGAGATGATGGCAGGC
GGCGGCAAAATGATCCTCGGGTCAGACAGCCACACCCGTTACGGTGCATTAGGGACAATG
GCAGTCGGTGAGGGCGGCGGTGAGTTGGTAAAACAGCTGCTTAATGACACCTGGGATATC
GACTATCCGGGCGTGGTTGCGGTGCATCTGACCGGAAAACCTGCGCCGTATGTGGGGCCA
CAGGATGTGGCGCTGGCTATCATTGGCGCGGTGTTCAAAAACGGTTACGTCAAAAACAAA
GTCATGGAGTTCGTTGGACCGGGCGTTAGCGCGCTCTCTACCGATTTCCGTAACAGCGTT
GACGTGATGACCACTGAAACGACCTGTTTAAGTTCTGTCTGGCAAACCGATGAAGAAGTC
CATAACTGGCTGGCGCTGCACGGTCGCGGCCAGGATTACTGCCAGCTTAACCCTCAACCG
ATGGCGTACTACGATGGCTGCATCAGCGTTGATTTAAGCGCCATCAAACCAATGATTGCG
CTGCCGTTCCACCCGAGCAACGTGTATGAAATCGACACACTGAACCAGAACCTGACCGAC
ATTCTGCGTGAGATTGAAATTGAGTCCGAACGCGTGGCGCACGGTAAAGCCAAACTCTCG
CTGCTGGATAAAGTGGAAAATGGTCGCCTGAAAGTGCAGCAGGGGATTATCGCGGGCTGT
TCTGGCGGTAACTACGAAAACGTCATCGCGGCGGCGAATGCACTGCGCGGTCAATCCTGT
GGCAATGACACCTTCTCGCTGGCAGTTTACCCGTCATCACAGCCGGTGTTTATGGATCTC
GCCAAAAAAGGTGTGGTAGCAGATTTGATTGGCGCAGGCGCAATCATCAGAACCGCGTTC
TGCGGCCCATGCTTTGGCGCGGGCGATACGCCAATCAACAACGGTTTGAGTATTCGCCAC
ACCACGCGTAACTTCCCGAACCGCGAAGGCTCTAAGCCAGCTAATGGGCAGATGTCAGCG
GTGGCGTTGATGGACGCTCGTTCTATCGCTGCGACTGCGGCAAACGGTGGCTATTTAACC
TCTGCCAGCGAACTTGATTGCTGGGACAACGTGCCGGAGTACGCCTTCGATGTAACGCCG
TATAAAAACCGTGTTTATCAGGGCTTTGTGAAAGGGGCAACTCAGCAACCGCTGATTTAC
GGGCCGAACATTAAAGACTGGCCGGAATTGGGTGCGCTGACTGACAATATCGTCCTGAAA
GTGTGCTCGAAGATCCTCGACGAAGTGACCACCACCGACGAACTGATTCCTTCCGGTGAA
ACCTCTTCTTATCGTTCAAATCCGATTGGTCTGGCGGAGTTTACCCTGTCTCGCCGCGAT
CCCGGTTATGTTAGCAGAAGTAAAGCGACTGCTGAGCTGGAAAATCAGCGTCTGGCGGGG
AATGTCAGCGAGCTGACAGAGGTGTTTGCGCGCATTAAGCAGATTGCTGGTCAGGAGCAT
ATTGATCCGCTGCAAACTGAAATTGGCAGCATGGTCTATGCGGTGAAACCAGGCGATGGT
TCTGCGCGTGAACAGGCGGCGAGCTGCCAGCGTGTGATTGGCGGTCTGGCGAATATTGCC
GAGGAGTACGCGACTAAACGCTATCGTTCTAACGTCATCAACTGGGGGATGTTACCGCTG
CAAATGGCGGAAGTACCAACCTTTGAAGTGGGGGATTACATTTACATCCCTGGCATTAAA
GCGGCGCTGGATAATCCGGGTACGACGTTTAAAGGTTATGTGATCCATGAAGATGCGCCG
GTAACGGAAATTACGCTCTATATGGAAAGTCTGACTGCTGAAGAGCGCGAGATTATCAAG
GCGGGTAGTTTGATTAACTTCAATAAAAACCGTCAGATGTAA
Protein Properties
Pfam Domain Function:
Protein Residues:753
Protein Molecular Weight:81504
Protein Theoretical pI:5
Signaling Regions:
  • None
Transmembrane Regions:
  • None
Protein Sequence:
>Uncharacterized protein ybhJ
MIKLSEKGVFLASNNEIIAEEHFTGEIKKEEAKKGTIAWSILSSHNTSGNMDKLKIKFDS
LASHDITFVGIVQTAKASGMERFPLPYVLTNCHNSLCAVGGTINGDDHVFGLSAAQRYGG
IFVPPHIAVIHQYMREMMAGGGKMILGSDSHTRYGALGTMAVGEGGGELVKQLLNDTWDI
DYPGVVAVHLTGKPAPYVGPQDVALAIIGAVFKNGYVKNKVMEFVGPGVSALSTDFRNSV
DVMTTETTCLSSVWQTDEEVHNWLALHGRGQDYCQLNPQPMAYYDGCISVDLSAIKPMIA
LPFHPSNVYEIDTLNQNLTDILREIEIESERVAHGKAKLSLLDKVENGRLKVQQGIIAGC
SGGNYENVIAAANALRGQSCGNDTFSLAVYPSSQPVFMDLAKKGVVADLIGAGAIIRTAF
CGPCFGAGDTPINNGLSIRHTTRNFPNREGSKPANGQMSAVALMDARSIAATAANGGYLT
SASELDCWDNVPEYAFDVTPYKNRVYQGFVKGATQQPLIYGPNIKDWPELGALTDNIVLK
VCSKILDEVTTTDELIPSGETSSYRSNPIGLAEFTLSRRDPGYVSRSKATAELENQRLAG
NVSELTEVFARIKQIAGQEHIDPLQTEIGSMVYAVKPGDGSAREQAASCQRVIGGLANIA
EEYATKRYRSNVINWGMLPLQMAEVPTFEVGDYIYIPGIKAALDNPGTTFKGYVIHEDAP
VTEITLYMESLTAEEREIIKAGSLINFNKNRQM
References
External Links:
ResourceLink
Uniprot ID:P75764
Uniprot Name:YBHJ_ECOLI
GenBank Gene ID:AP009048
Genebank Protein ID:85674754
Ecogene ID:EG13666
Ecocyc:EG13666
ColiBase:b0771
Kegg Gene:b0771
EchoBASE ID:EB3430
CCDB:YBHJ_ECOLI
BacMap:90111167
General Reference:
  • Blattner, F. R., Plunkett, G. 3rd, Bloch, C. A., Perna, N. T., Burland, V., Riley, M., Collado-Vides, J., Glasner, J. D., Rode, C. K., Mayhew, G. F., Gregor, J., Davis, N. W., Kirkpatrick, H. A., Goeden, M. A., Rose, D. J., Mau, B., Shao, Y. (1997). "The complete genome sequence of Escherichia coli K-12." Science 277:1453-1462. Pubmed: 9278503
  • Hayashi, K., Morooka, N., Yamamoto, Y., Fujita, K., Isono, K., Choi, S., Ohtsubo, E., Baba, T., Wanner, B. L., Mori, H., Horiuchi, T. (2006). "Highly accurate genome sequences of Escherichia coli K-12 strains MG1655 and W3110." Mol Syst Biol 2:2006.0007. Pubmed: 16738553
  • Oshima, T., Aiba, H., Baba, T., Fujita, K., Hayashi, K., Honjo, A., Ikemoto, K., Inada, T., Itoh, T., Kajihara, M., Kanai, K., Kashimoto, K., Kimura, S., Kitagawa, M., Makino, K., Masuda, S., Miki, T., Mizobuchi, K., Mori, H., Motomura, K., Nakamura, Y., Nashimoto, H., Nishio, Y., Saito, N., Horiuchi, T., et, a. l. .. (1996). "A 718-kb DNA sequence of the Escherichia coli K-12 genome corresponding to the 12.7-28.0 min region on the linkage map." DNA Res 3:137-155. Pubmed: 8905232