N,N'-diacetylchitobiose-specific phosphotransferase enzyme IIB component (P69795)

Identification
Name:N,N'-diacetylchitobiose-specific phosphotransferase enzyme IIB component
Synonyms:
  • PTS system N,N'-diacetylchitobiose-specific EIIB component
Gene Name:chbB
Enzyme Class:
Biological Properties
General Function:Involved in protein-N(PI)-phosphohistidine-sugar phosphotransferase activity
Specific Function:The phosphoenolpyruvate-dependent sugar phosphotransferase system (sugar PTS), a major carbohydrate active -transport system, catalyzes the phosphorylation of incoming sugar substrates concomitantly with their translocation across the cell membrane. This system is involved in N,N'-diacetylchitobiose transport
Cellular Location:Cytoplasm
SMPDB Pathways:
KEGG Pathways:
KEGG Reactions:
1.0Protein N(pi)-phospho-L-histidine+1.0Sugar ↔ 1.0Protein histidine+1.0Thumb
1.0Protein N(pi)-phospho-L-histidine + 1.0Sugar ↔ 1.0Protein histidine + 1.0Sugar phosphate
ReactionCard
Complex Reactions:
1.0Protein EIIB N(pi)-phospho-L-histidine/cysteine+1.0Thumb → 1.0protein EIIB+1.0sugar phosphate
1.0Protein EIIB N(pi)-phospho-L-histidine/cysteine + 1.0Sucrose → 1.0protein EIIB + 1.0sugar phosphate
ReactionCard
Metabolites:
ECMDB IDNameView
ECMDB00258SucroseMetaboCard
GO Classification:
Function
binding
carbohydrate binding
carbohydrate transmembrane transporter activity
protein-N(PI)-phosphohistidine-sugar phosphotransferase activity
substrate-specific transmembrane transporter activity
sugar binding
transmembrane transporter activity
transporter activity
Process
carbohydrate transport
establishment of localization
phosphoenolpyruvate-dependent sugar phosphotransferase system
transport
Gene Properties
Blattner:b1738
Gene OrientationCounterclockwise
Centisome Percentage:39.21
Left Sequence End1819323
Right Sequence End1819643
Gene Sequence:
>321 bp
ATGAAAATAACATTACTGGTTACCTTGCTTTTCGGTCTGGTTTTTTTAACCACCGTCGGC
GCTGCCGAGAGAACTTTAACCCCACAACAACAGCGTATGACCTCCTGTAATCAGCAGGCG
ACGGCGCAGGCGTTGAAAGGGGATGCTCGTAAGACCTACATGAGTGATTGCCTGAAGAAC
AGCAAGTCTGCGCCTGGCGAAAAAAGTTTGACGCCACAGCAGCAAAAGATGCGCGAATGC
AATAATCAAGCAACACAACAATCTCTGAAAGGTGATGATCGTAATAAGTTTATGAGTGCC
TGCCTCAAGAAAGCCGCCTGA
Protein Properties
Pfam Domain Function:
Protein Residues:106
Protein Molecular Weight:11426
Protein Theoretical pI:8
PDB File:1IIB
Signaling Regions:
  • None
Transmembrane Regions:
  • None
Protein Sequence:
>N,N'-diacetylchitobiose-specific phosphotransferase enzyme IIB component
MEKKHIYLFCSAGMSTSLLVSKMRAQAEKYEVPVIIEAFPETLAGEKGQNADVVLLGPQI
AYMLPEIQRLLPNKPVEVIDSLLYGKVDGLGVLKAAVAAIKKAAAN
References
External Links:
ResourceLink
Uniprot ID:P69795
Uniprot Name:PTQB_ECOLI
GenBank Gene ID:AP009048
Genebank Protein ID:85674525
PDB ID:1IIB
Ecogene ID:EG10140
Ecocyc:EG10140
ColiBase:b1738
Kegg Gene:b1738
EchoBASE ID:EB0138
CCDB:PTQB_ECOLI
BacMap:16129692
General Reference:
  • Ab, E., Schuurman-Wolters, G. K., Saier, M. H., Reizer, J., Jacuinod, M., Roepstorff, P., Dijkstra, K., Scheek, R. M., Robillard, G. T. (1994). "Enzyme IIBcellobiose of the phosphoenol-pyruvate-dependent phosphotransferase system of Escherichia coli: backbone assignment and secondary structure determined by three-dimensional NMR spectroscopy." Protein Sci 3:282-290. Pubmed: 8003964
  • Ab, E., Schuurman-Wolters, G., Reizer, J., Saier, M. H., Dijkstra, K., Scheek, R. M., Robillard, G. T. (1997). "The NMR side-chain assignments and solution structure of enzyme IIBcellobiose of the phosphoenolpyruvate-dependent phosphotransferase system of Escherichia coli." Protein Sci 6:304-314. Pubmed: 9041631
  • Aiba, H., Baba, T., Hayashi, K., Inada, T., Isono, K., Itoh, T., Kasai, H., Kashimoto, K., Kimura, S., Kitakawa, M., Kitagawa, M., Makino, K., Miki, T., Mizobuchi, K., Mori, H., Mori, T., Motomura, K., Nakade, S., Nakamura, Y., Nashimoto, H., Nishio, Y., Oshima, T., Saito, N., Sampei, G., Horiuchi, T., et, a. l. .. (1996). "A 570-kb DNA sequence of the Escherichia coli K-12 genome corresponding to the 28.0-40.1 min region on the linkage map." DNA Res 3:363-377. Pubmed: 9097039
  • Blattner, F. R., Plunkett, G. 3rd, Bloch, C. A., Perna, N. T., Burland, V., Riley, M., Collado-Vides, J., Glasner, J. D., Rode, C. K., Mayhew, G. F., Gregor, J., Davis, N. W., Kirkpatrick, H. A., Goeden, M. A., Rose, D. J., Mau, B., Shao, Y. (1997). "The complete genome sequence of Escherichia coli K-12." Science 277:1453-1462. Pubmed: 9278503
  • Hayashi, K., Morooka, N., Yamamoto, Y., Fujita, K., Isono, K., Choi, S., Ohtsubo, E., Baba, T., Wanner, B. L., Mori, H., Horiuchi, T. (2006). "Highly accurate genome sequences of Escherichia coli K-12 strains MG1655 and W3110." Mol Syst Biol 2:2006.0007. Pubmed: 16738553
  • Keyhani, N. O., Bacia, K., Roseman, S. (2000). "The transport/phosphorylation of N,N'-diacetylchitobiose in Escherichia coli. Characterization of phospho-IIB(Chb) and of a potential transition state analogue in the phosphotransfer reaction between the proteins IIA(Chb) AND IIB(Chb)." J Biol Chem 275:33102-33109. Pubmed: 10913119
  • Keyhani, N. O., Roseman, S. (1997). "Wild-type Escherichia coli grows on the chitin disaccharide, N,N'-diacetylchitobiose, by expressing the cel operon." Proc Natl Acad Sci U S A 94:14367-14371. Pubmed: 9405618
  • Keyhani, N. O., Wang, L. X., Lee, Y. C., Roseman, S. (2000). "The chitin disaccharide, N,N'-diacetylchitobiose, is catabolized by Escherichia coli and is transported/phosphorylated by the phosphoenolpyruvate:glycose phosphotransferase system." J Biol Chem 275:33084-33090. Pubmed: 10913117
  • Keyhani, N., Rodgers, M. E., Demeler, B., Hansen, J. C., Roseman, S. (2000). "Analytical sedimentation of the IIAChb and IIBChb proteins of the Escherichia coli N,N'-diacetylchitobiose phosphotransferase system. Demonstration of a model phosphotransfer transition state complex." J Biol Chem 275:33110-33115. Pubmed: 10913122
  • Parker, L. L., Hall, B. G. (1990). "Characterization and nucleotide sequence of the cryptic cel operon of Escherichia coli K12." Genetics 124:455-471. Pubmed: 2179047
  • Reizer, J., Reizer, A., Saier, M. H. Jr (1990). "The cellobiose permease of Escherichia coli consists of three proteins and is homologous to the lactose permease of Staphylococcus aureus." Res Microbiol 141:1061-1067. Pubmed: 2092358
  • van Montfort, R. L., Pijning, T., Kalk, K. H., Reizer, J., Saier, M. H. Jr, Thunnissen, M. M., Robillard, G. T., Dijkstra, B. W. (1997). "The structure of an energy-coupling protein from bacteria, IIBcellobiose, reveals similarity to eukaryotic protein tyrosine phosphatases." Structure 5:217-225. Pubmed: 9032081