Identification
Name:Hydrogenase-2 small chain
Synonyms:
  • HYD2
  • Membrane-bound hydrogenase 2 small subunit
  • NiFe hydrogenase
Gene Name:hybO
Enzyme Class:
Biological Properties
General Function:Involved in NADH dehydrogenase (ubiquinone) activity
Specific Function:This is one of three E.coli hydrogenases synthesized in response to different physiological conditions. HYD2 is involved in hydrogen uptake
Cellular Location:Cell membrane; Peripheral membrane protein; Periplasmic side. Periplasm
SMPDB Pathways:Not Available
KEGG Pathways:
  • Microbial metabolism in diverse environments ec01120
  • Trinitrotoluene degradation ec00633
KEGG Reactions:
2,4-Diamino-6-nitrotoluene2,4-Diamino-6-hydroxylaminotoluene
2,4-Diamino-6-nitrotoluene ↔ 2,4-Diamino-6-hydroxylaminotoluene
ReactionCard
Thumb+AcceptorReduced acceptor
Hydrogen (gas) + Acceptor ↔ Reduced acceptor
ReactionCard
Complex Reactions:
2 Thumb+Thumb+ThumbThumb+2 Thumb
Thumb+2 Thumb+ThumbThumb+2 Thumb
2 Thumb+Thumb+Menaquinone 8Thumb+2 Thumb
Thumb+AAH(2)
Metabolites:
ECMDB IDNameView
ECMDB211542-Demethylmenaquinol 8MetaboCard
ECMDB211552-Demethylmenaquinone 8MetaboCard
ECMDB01362Hydrogen (gas)MetaboCard
ECMDB21225Hydrogen ionMetaboCard
ECMDB21245Menaquinol 8MetaboCard
ECMDB01060Ubiquinol-8MetaboCard
ECMDB21296Ubiquinone-8MetaboCard
GO Classification:
Component
ferredoxin hydrogenase complex
macromolecular complex
protein complex
Function
4 iron, 4 sulfur cluster binding
binding
catalytic activity
cofactor binding
ferredoxin hydrogenase activity
iron-sulfur cluster binding
metal cluster binding
NADH dehydrogenase (quinone) activity
NADH dehydrogenase (ubiquinone) activity
NADH dehydrogenase activity
oxidoreductase activity
oxidoreductase activity, acting on hydrogen as donor
oxidoreductase activity, acting on hydrogen as donor, iron-sulfur protein as acceptor
oxidoreductase activity, acting on NADH or NADPH
quinone binding
Process
metabolic process
oxidation reduction
Gene Properties
Blattner:b2997
Gene OrientationCounterclockwise
Centisome Percentage:67.75
Left Sequence End3143165
Right Sequence End3144283
Gene Sequence:
>1119 bp
ATGAGCCTGCCTTTTTTACGCACGCTGCAAGGCGATCGTTTTTTTCAGTTATTAATTCTT
GTTGGTATCGGATTAAGCTTTTTCGTGCCCTTTGCACCGAAATCCTGGCCTGCTGCTATC
GACTGGCACACCATCATCACCTTAAGCGGCCTGATGCTGCTGACCAAAGGTGTGGAGTTA
AGCGGTTATTTTGATGTGCTGGGGCGCAAAATGGTGCGCCGCTTTGCTACGGAGCGTCGG
CTGGCGATGTTTATGGTGCTGGCGGCGGCGCTGCTTTCTACCTTTCTGACCAACGATGTC
GCGCTGTTTATTGTTGTTCCGCTGACTATCACGCTAAAAAGACTGTGTGAGATCCCGGTT
AATCGGCTGATTATTTTTGAGGCGCTGGCAGTCAACGCTGGTTCGCTACTGACGCCAATT
GGCAACCCGCAAAATATTCTTATCTGGGGACGTTCTGGTCTTTCGTTTGCCGGATTTATT
GCCCAAATGGCACCGCTGGCTGGCGCAATGATGCTGACGCTCCTGCTCCTGTGCTGGTGT
TGTTTCCCTGGAAAGGCGATGCAATACCATACGGGGGTGCAAACACCGGAGTGGAAACCG
CGGCTGGTGTGGAGTTGTCTGGGGCTGTATATCGTCTTTCTGACGGCGCTGGAGTTCAAA
CAAGAGCTGTGGGGACTGGTGATTGTGGCGGCAGGCTTTGCGCTGCTGGCACGTCGCGTG
GTGCTCAGTGTGGACTGGACGCTGCTGCTGGTGTTTATGGCGATGTTTATCGACGTCCAT
TTACTGACCCAGCTTCCAGCGTTGCAAGGCGTGTTGGGTAACGTGAGTCATCTATCTGAA
CCCGGGTTATGGTTAACGGCAATCGGTTTATCGCAGGTGATCAGTAACGTGCCGAGTACC
ATATTGTTGCTGAACTATGTGCCGCCGTCTTTATTACTGGTATGGGCGGTAAACGTAGGT
GGCTTTGGGTTATTACCCGGATCGCTGGCAAATTTGATTGCGCTACGTATGGCGAACGAT
CGCCGCATCTGGTGGCGTTTCCATCTCTATTCAATACCGATGCTGTTGTGGGCGGCGTTG
GTGGGATATGTTTTGTTAGTTATACTCCCGGCCAACTAG
Protein Properties
Pfam Domain Function:
Protein Residues:372
Protein Molecular Weight:39652
Protein Theoretical pI:7
Signaling Regions:
  • 1-37
Transmembrane Regions:
  • None
Protein Sequence:
>Hydrogenase-2 small chain
MTGDNTLIHSHGINRRDFMKLCAALAATMGLSSKAAAEMAESVTNPQRPPVIWIGAQECT
GCTESLLRATHPTVENLVLETISLEYHEVLSAAFGHQVEENKHNALEKYKGQYVLVVDGS
IPLKDNGIYCMVAGEPIVDHIRKAAEGAAAIIAIGSCSAWGGVAAAGVNPTGAVSLQEVL
PGKTVINIPGCPPNPHNFLATVAHIITYGKPPKLDDKNRPTFAYGRLIHEHCERRPHFDA
GRFAKEFGDEGHREGWCLYHLGCKGPETYGNCSTLQFCDVGGVWPVAIGHPCYGCNEEGI
GFHKGIHQLANVENQTPRSQKPDVNAKEGGNVSAGAIGLLGGVVGLVAGVSVMAVRELGR
QQKKDNADSRGE
References
External Links:
ResourceLink
Uniprot ID:P69741
Uniprot Name:MBHT_ECOLI
GenBank Gene ID:AP009048
Genebank Protein ID:4062385
Ecogene ID:EG13006
Ecocyc:EG13006
ColiBase:b2997
Kegg Gene:b2997
EchoBASE ID:EB2828
CCDB:MBHT_ECOLI
BacMap:16130897
General Reference:
  • Blattner, F. R., Plunkett, G. 3rd, Bloch, C. A., Perna, N. T., Burland, V., Riley, M., Collado-Vides, J., Glasner, J. D., Rode, C. K., Mayhew, G. F., Gregor, J., Davis, N. W., Kirkpatrick, H. A., Goeden, M. A., Rose, D. J., Mau, B., Shao, Y. (1997). "The complete genome sequence of Escherichia coli K-12." Science 277:1453-1462. Pubmed: 9278503
  • Hayashi, K., Morooka, N., Yamamoto, Y., Fujita, K., Isono, K., Choi, S., Ohtsubo, E., Baba, T., Wanner, B. L., Mori, H., Horiuchi, T. (2006). "Highly accurate genome sequences of Escherichia coli K-12 strains MG1655 and W3110." Mol Syst Biol 2:2006.0007. Pubmed: 16738553
  • Sargent, F., Ballantine, S. P., Rugman, P. A., Palmer, T., Boxer, D. H. (1998). "Reassignment of the gene encoding the Escherichia coli hydrogenase 2 small subunit--identification of a soluble precursor of the small subunit in a hypB mutant." Eur J Biochem 255:746-754. Pubmed: 9738917
  • Tullman-Ercek, D., DeLisa, M. P., Kawarasaki, Y., Iranpour, P., Ribnicky, B., Palmer, T., Georgiou, G. (2007). "Export pathway selectivity of Escherichia coli twin arginine translocation signal peptides." J Biol Chem 282:8309-8316. Pubmed: 17218314