Identification
Name:Adenine phosphoribosyltransferase
Synonyms:
  • APRT
Gene Name:apt
Enzyme Class:
Biological Properties
General Function:Involved in adenine phosphoribosyltransferase activity
Specific Function:Catalyzes a salvage reaction resulting in the formation of AMP, that is energically less costly than de novo synthesis
Cellular Location:Cytoplasm
SMPDB Pathways:
KEGG Pathways:
KEGG Reactions:
Thumb+ThumbThumb+Thumb
Thumb+ThumbThumb+Thumb
Thumb+ThumbThumb+Thumb
Thumb+ThumbThumb+Thumb
Thumb+ThumbThumb+Thumb
Thumb+ThumbThumb+Thumb
SMPDB Reactions:
Thumb+ThumbPyrophosphate+Thumb
EcoCyc Reactions:
Thumb+ThumbThumb+Thumb
Thumb+ThumbThumb+Thumb
Thumb+ThumbThumb+Thumb
Complex Reactions:
Thumb+ThumbThumb+Thumb
Metabolites:
ECMDB IDNameView
ECMDB200985-Amino-4-imidazolecarboxyamideMetaboCard
ECMDB00034AdenineMetaboCard
ECMDB00045Adenosine monophosphateMetaboCard
ECMDB01517AICARMetaboCard
ECMDB00132GuanineMetaboCard
ECMDB01397Guanosine monophosphateMetaboCard
ECMDB00280Phosphoribosyl pyrophosphateMetaboCard
ECMDB04142PyrophosphateMetaboCard
GO Classification:
Component
cell part
cytoplasm
intracellular part
Function
adenine phosphoribosyltransferase activity
catalytic activity
transferase activity
transferase activity, transferring glycosyl groups
transferase activity, transferring pentosyl groups
Process
adenine salvage
cellular aromatic compound metabolic process
cellular metabolic process
cellular nitrogen compound metabolic process
metabolic process
nitrogen compound metabolic process
nucleobase metabolic process
nucleobase, nucleoside and nucleotide metabolic process
nucleobase, nucleoside, nucleotide and nucleic acid metabolic process
nucleoside metabolic process
purine base biosynthetic process
purine base metabolic process
purine base salvage
Gene Properties
Blattner:b0469
Gene OrientationClockwise
Centisome Percentage:10.57
Left Sequence End490636
Right Sequence End491187
Gene Sequence:
>552 bp
ATGTTGTTAGAACAGGGGTGGCTGGTTGGCGCGCGCCGCGTTCCCTCACCACATTACGAT
TGCCGCCCGGATGACGAAACACCCACCCTGCTGGTGGTGCACAATATTAGCCTGCCGCCA
GGCGAGTTTGGCGGTCCGTGGATCGACGCATTATTCACTGGAACTATTGATCCGCAGGCA
CATCCTTTCTTTGCTGAGATCGCCCATTTGCGCGTCTCCGCTCACTGTTTGATTCGCCGT
GATGGTGAAATAGTCCAGTATGTTCCTTTCGATAAACGTGCATGGCATGCGGGAGTCTCT
CAGTATCAGGGGCGCGAACGCTGCAATGATTTTTCTATTGGGATTGAGCTTGAAGGCACC
GATACGCTGGCGTATACCGATGCGCAGTATCAACAGCTTGCGGCGGTTACGCGGGCACTG
ATTGATTGCTATCCGGATATCGCTAAAAACATGACGGGCCATTGTGATATTGCGCCGGAT
CGGAAAACCGATCCCGGTCCTGCATTTGATTGGGCACGGTTTCGTGTGCTGGTCAGCAAG
GAGACAACATGA
Protein Properties
Pfam Domain Function:
Protein Residues:183
Protein Molecular Weight:19859
Protein Theoretical pI:5
Signaling Regions:
  • None
Transmembrane Regions:
  • None
Protein Sequence:
>Adenine phosphoribosyltransferase
MTATAQQLEYLKNSIKSIQDYPKPGILFRDVTSLLEDPKAYALSIDLLVERYKNAGITKV
VGTEARGFLFGAPVALGLGVGFVPVRKPGKLPRETISETYDLEYGTDQLEIHVDAIKPGD
KVLVVDDLLATGGTIEATVKLIRRLGGEVADAAFIINLFDLGGEQRLEKQGITSYSLVPF
PGH
References
External Links:
ResourceLink
Uniprot ID:P69503
Uniprot Name:APT_ECOLI
GenBank Gene ID:AP009048
Genebank Protein ID:21238958
Ecogene ID:EG10051
Ecocyc:EG10051
ColiBase:b0469
Kegg Gene:b0469
EchoBASE ID:EB0049
CCDB:APT_ECOLI
BacMap:16128453
General Reference:
  • Blattner, F. R., Plunkett, G. 3rd, Bloch, C. A., Perna, N. T., Burland, V., Riley, M., Collado-Vides, J., Glasner, J. D., Rode, C. K., Mayhew, G. F., Gregor, J., Davis, N. W., Kirkpatrick, H. A., Goeden, M. A., Rose, D. J., Mau, B., Shao, Y. (1997). "The complete genome sequence of Escherichia coli K-12." Science 277:1453-1462. Pubmed: 9278503
  • Flower, A. M., McHenry, C. S. (1986). "The adjacent dnaZ and dnaX genes of Escherichia coli are contained within one continuous open reading frame." Nucleic Acids Res 14:8091-8101. Pubmed: 3534795
  • Hayashi, K., Morooka, N., Yamamoto, Y., Fujita, K., Isono, K., Choi, S., Ohtsubo, E., Baba, T., Wanner, B. L., Mori, H., Horiuchi, T. (2006). "Highly accurate genome sequences of Escherichia coli K-12 strains MG1655 and W3110." Mol Syst Biol 2:2006.0007. Pubmed: 16738553
  • Hershey, H. V., Taylor, M. W. (1986). "Nucleotide sequence and deduced amino acid sequence of Escherichia coli adenine phosphoribosyltransferase and comparison with other analogous enzymes." Gene 43:287-293. Pubmed: 3527873
  • Zhang, X., Zhu, L., Deutscher, M. P. (1998). "Oligoribonuclease is encoded by a highly conserved gene in the 3'-5' exonuclease superfamily." J Bacteriol 180:2779-2781. Pubmed: 9573169