Identification
Name:Probable pyruvate-flavodoxin oxidoreductase
Synonyms:Not Available
Gene Name:ydbK
Enzyme Class:
Biological Properties
General Function:Involved in electron carrier activity
Specific Function:Oxidoreductase required for the transfer of electrons from pyruvate to flavodoxin (Potential)
Cellular Location:Not Available
SMPDB Pathways:
KEGG Pathways:
KEGG Reactions:
2 Reduced ferredoxin+Thumb+Thumb+2 Thumb+Oxidized ferredoxin2 Oxidized ferredoxin+Thumb+Thumb+Reduced ferredoxin
2 Reduced ferredoxin + Acetyl-CoA + Carbon dioxide + 2 Hydrogen ion + Oxidized ferredoxin ↔ 2 Oxidized ferredoxin + Pyruvic acid + Coenzyme A + Reduced ferredoxin
ReactionCard
Complex Reactions:
Thumb+2 flavodoxin semi oxidized+ThumbThumb+Thumb+2 Flavodoxin reduced+Thumb
Coenzyme A + 2 flavodoxin semi oxidized + Pyruvic acidAcetyl-CoA + Carbon dioxide + 2 Flavodoxin reduced + Hydrogen ion
ReactionCard
Metabolites:
ECMDB IDNameView
ECMDB01206Acetyl-CoAMetaboCard
ECMDB04030Carbon dioxideMetaboCard
ECMDB01423Coenzyme AMetaboCard
ECMDB21225Hydrogen ionMetaboCard
ECMDB00243Pyruvic acidMetaboCard
GO Classification:
Function
binding
catalytic activity
cation binding
electron carrier activity
ion binding
iron ion binding
iron-sulfur cluster binding
metal cluster binding
metal ion binding
oxidoreductase activity
oxidoreductase activity, acting on the aldehyde or oxo group of donors
thiamin pyrophosphate binding
transition metal ion binding
vitamin binding
Process
metabolic process
oxidation reduction
Gene Properties
Blattner:b1378
Gene OrientationCounterclockwise
Centisome Percentage:30.94
Left Sequence End1435284
Right Sequence End1438808
Gene Sequence:
>3525 bp
ATGATTACTATTGACGGTAATGGCGCGGTTGCTTCGGTCGCATTTCGCACCAGTGAAGTT
ATCGCCATCTACCCTATTACCCCCAGTTCCACGATGGCAGAACAGGCTGATGCCTGGGCC
GGAAACGGCTTAAAGAACGTTTGGGGAGACACACCACGCGTGGTTGAAATGCAGTCGGAA
GCGGGTGCTATCGCTACCGTGCATGGCGCTTTGCAGACGGGTGCCCTTTCAACATCGTTT
ACGTCATCGCAGGGTTTGCTGCTGATGATCCCGACGCTGTACAAACTGGCAGGCGAACTA
ACACCGTTTGTCCTGCATGTAGCGGCACGTACCGTTGCCACACATGCACTCTCTATTTTT
GGCGATCATTCCGACGTTATGGCGGTGCGCCAGACGGGTTGCGCGATGTTGTGTGCAGCA
AACGTCCAGGAAGCGCAAGACTTTGCTCTCATTTCGCAAATCGCGACGCTGAAAAGCCGC
GTGCCATTTATTCATTTCTTTGATGGTTTCCGCACGTCCCACGAAATCAATAAAATTGTC
CCGCTGGCCGATGACACGATTCTTGATCTCATGCCGCAGGTCGAAATTGATGCTCATCGC
GCCCGGGCACTCAACCCGGAACATCCGGTGATCCGCGGTACGTCCGCCAATCCTGACACT
TATTTCCAGTCTCGCGAAGCCACCAACCCATGGTACAACGCGGTCTATGACCATGTTGAA
CAGGCGATGAATGATTTCTCTGCCGCGACAGGTCGTCAGTATCAGCCGTTTGAATATTAC
GGGCATCCGCAAGCGGAACGGGTGATTATCCTGATGGGCTCTGCCATTGGCACCTGTGAA
GAAGTGGTTGATGAATTGCTAACCCGTGGCGAAAAAGTTGGCGTGCTGAAAGTTCGCCTG
TACCGCCCCTTCTCCGCTAAACATTTACTGCAAGCTCTGCCGGGATCCGTACGCAGCGTG
GCGGTACTGGACAGAACCAAAGAACCCGGTGCCCAGGCAGAACCGCTCTATCTGGATGTA
ATGACCGCACTGGCAGAAGCCTTTAATAATGGCGAGCGCGAAACTCTGCCCCGTGTCATT
GGTGGGCGCTATGGTCTTTCATCCAAAGAATTTGGCCCAGACTGTGTACTGGCGGTATTT
GCCGAGCTCAACGCGGCTAAACCGAAAGCGCGCTTTACGGTTGGTATTTACGATGATGTG
ACCAATCTGTCACTGCCGTTGCCGGAAAACACCCTGCCAAACTCGGCGAAACTGGAAGCC
TTGTTTTATGGCCTTGGTAGTGATGGCAGCGTTTCCGCGACCAAAAACAATATCAAGATT
ATCGGTAATTCCACGCCGTGGTACGCACAGGGCTATTTTGTTTACGACTCCAAAAAGGCG
GGCGGCCTGACGGTTTCTCACCTTCGAGTGAGCGAACAGCCGATTCGTTCCGCTTATCTC
ATTTCCCAGGCTGATTTTGTTGGCTGCCACCAGTTGCAGTTTATCGATAAATATCAGATG
GCTGAGCGTTTAAAACCTGGCGGCATTTTCCTGCTCAACACGCCGTACAGCGCAGATGAA
GTGTGGTCGCGCTTGCCGCAAGAAGTTCAGGCCGTGTTAAACCAGAAAAAAGCGCGCTTC
TATGTGATTAACGCGGCGAAAATCGCCCGCGAATGTGGCCTGGCGGCCCGTATTAATACC
GTCATGCAGATGGCTTTTTTCCATCTGACGCAAATTCTGCCTGGCGATAGCGCCCTCGCA
GAATTGCAGGGTGCGATTGCCAAAAGTTACAGTAGCAAAGGCCAGGATCTGGTGGAACGC
AACTGGCAGGCTCTGGCGCTGGCGCGTGAATCCGTAGAAGAAGTTCCGTTGCAACCGGTA
AATCCGCACAGCGCCAATCGACCGCCAGTGGTTTCCGATGCCGCCCCTGATTTCGTGAAA
ACCGTAACCGCTGCGATGCTCGCCGGGCTTGGTGACGCCCTCCCCGTTTCGGCGCTGCCG
CCAGACGGCACCTGGCCGATGGGCACTACGCGCTGGGAAAAACGCAATATCGCCGAAGAG
ATCCCCATCTGGAAAGAGGAACTCTGTACCCAATGTAACCACTGCGTTGCCGCTTGCCCA
CACTCAGCTATTCGCGCAAAAGTGGTGCCGCCTGAAGCGATGGAAAACGCCCCTGCCAGC
CTGCATTCGCTGGATGTGAAATCGCGTGATATGCGCGGGCAGAAATATGTCTTGCAGGTG
GCACCGGAAGATTGCACCGGTTGTAACCTGTGCGTCGAAGTTTGCCCGGCGAAAGACCGT
CAGAATCCAGAGATTAAAGCCATCAATATGATGTCTCGCCTGGAACATGTCGAAGAAGAG
AAAATCAATTACGATTTCTTCCTCAACCTGCCAGAAATCGACCGTAGCAAACTGGAACGT
ATTGATATTCGTACATCGCAGCTGATTACACCGCTGTTTGAATATTCAGGTGCTTGCTCC
GGTTGTGGCGAGACGCCGTATATTAAATTACTGACTCAGCTCTATGGCGACCGGATGTTG
ATCGCTAACGCCACTGGCTGTTCTTCAATTTATGGCGGTAACCTGCCCTCTACACCGTAT
ACCACCGATGCCAACGGTCGTGGGCCGGCATGGGCGAACTCTCTATTTGAAGATAATGCC
GAATTTGGCCTTGGTTTCCGCCTGACGGTCGATCAACACCGTGTCCGCGTGCTGCGTCTG
CTGGATCAATTTGCCGATAAAATCCCGGCGGAATTACTGACGGCGTTGAAATCAGACGCC
ACGCCAGAGGTTCGTCGTGAACAGGTTGCAGCTTTACGCCAGCAACTCAACGATGTTGCC
GAAGCACATGAACTGCTACGTGATGCAGATGCACTGGTGGAAAAATCAATCTGGCTGATT
GGTGGTGATGGCTGGGCTTACGATATCGGCTTTGGCGGTCTGGATCATGTATTGAGTTTG
ACGGAAAACGTCAACATTCTGGTGCTGGATACGCAATGCTATTCCAACACCGGTGGTCAG
GCGTCGAAAGCGACACCGCTGGGTGCAGTAACTAAATTTGGCGAGCACGGCAAACGTAAA
GCGCGTAAAGATCTTGGCGTCAGTATGATGATGTACGGTCATGTTTATGTGGCGCAGATT
TCTCTCGGCGCGCAGCTGAACCAGACGGTGAAAGCGATTCAGGAAGCGGAAGCGTATCCG
GGGCCATCGCTGATCATTGCTTATAGCCCGTGTGAAGAGCATGGTTACGATCTGGCACTC
AGCCACGACCAGATGCGCCAACTCACAGCTACCGGCTTCTGGCCGCTATATCGCTTTGAT
CCGCGTCGTGCCGATGAAGGCAAACTGCCGCTGGCCTTGGATTCACGCCCGCCGTCAGAA
GCACCGGAAGAAACGTTACTTCACGAGCAACGTTTCCGTCGGCTGAATTCGCAGCAGCCA
GAAGTGGCAGAACAGTTATGGAAAGATGCTGCAGCTGATTTGCAAAAACGCTATGACTTC
CTGGCACAAATGGCCGGAAAAGCGGAAAAAAGCAACACCGATTAA
Protein Properties
Pfam Domain Function:
Protein Residues:1174
Protein Molecular Weight:128823
Protein Theoretical pI:6
Signaling Regions:
  • None
Transmembrane Regions:
  • None
Protein Sequence:
>Probable pyruvate-flavodoxin oxidoreductase
MITIDGNGAVASVAFRTSEVIAIYPITPSSTMAEQADAWAGNGLKNVWGDTPRVVEMQSE
AGAIATVHGALQTGALSTSFTSSQGLLLMIPTLYKLAGELTPFVLHVAARTVATHALSIF
GDHSDVMAVRQTGCAMLCAANVQEAQDFALISQIATLKSRVPFIHFFDGFRTSHEINKIV
PLADDTILDLMPQVEIDAHRARALNPEHPVIRGTSANPDTYFQSREATNPWYNAVYDHVE
QAMNDFSAATGRQYQPFEYYGHPQAERVIILMGSAIGTCEEVVDELLTRGEKVGVLKVRL
YRPFSAKHLLQALPGSVRSVAVLDRTKEPGAQAEPLYLDVMTALAEAFNNGERETLPRVI
GGRYGLSSKEFGPDCVLAVFAELNAAKPKARFTVGIYDDVTNLSLPLPENTLPNSAKLEA
LFYGLGSDGSVSATKNNIKIIGNSTPWYAQGYFVYDSKKAGGLTVSHLRVSEQPIRSAYL
ISQADFVGCHQLQFIDKYQMAERLKPGGIFLLNTPYSADEVWSRLPQEVQAVLNQKKARF
YVINAAKIARECGLAARINTVMQMAFFHLTQILPGDSALAELQGAIAKSYSSKGQDLVER
NWQALALARESVEEVPLQPVNPHSANRPPVVSDAAPDFVKTVTAAMLAGLGDALPVSALP
PDGTWPMGTTRWEKRNIAEEIPIWKEELCTQCNHCVAACPHSAIRAKVVPPEAMENAPAS
LHSLDVKSRDMRGQKYVLQVAPEDCTGCNLCVEVCPAKDRQNPEIKAINMMSRLEHVEEE
KINYDFFLNLPEIDRSKLERIDIRTSQLITPLFEYSGACSGCGETPYIKLLTQLYGDRML
IANATGCSSIYGGNLPSTPYTTDANGRGPAWANSLFEDNAEFGLGFRLTVDQHRVRVLRL
LDQFADKIPAELLTALKSDATPEVRREQVAALRQQLNDVAEAHELLRDADALVEKSIWLI
GGDGWAYDIGFGGLDHVLSLTENVNILVLDTQCYSNTGGQASKATPLGAVTKFGEHGKRK
ARKDLGVSMMMYGHVYVAQISLGAQLNQTVKAIQEAEAYPGPSLIIAYSPCEEHGYDLAL
SHDQMRQLTATGFWPLYRFDPRRADEGKLPLALDSRPPSEAPEETLLHEQRFRRLNSQQP
EVAEQLWKDAAADLQKRYDFLAQMAGKAEKSNTD
References
External Links:
ResourceLink
Uniprot ID:P52647
Uniprot Name:NIFJ_ECOLI
GenBank Gene ID:AP009048
Genebank Protein ID:1742250
Ecogene ID:EG13183
Ecocyc:EG13183
ColiBase:b1378
Kegg Gene:b1378
EchoBASE ID:EB2975
CCDB:NIFJ_ECOLI
BacMap:16129339
General Reference:
  • Aiba, H., Baba, T., Hayashi, K., Inada, T., Isono, K., Itoh, T., Kasai, H., Kashimoto, K., Kimura, S., Kitakawa, M., Kitagawa, M., Makino, K., Miki, T., Mizobuchi, K., Mori, H., Mori, T., Motomura, K., Nakade, S., Nakamura, Y., Nashimoto, H., Nishio, Y., Oshima, T., Saito, N., Sampei, G., Horiuchi, T., et, a. l. .. (1996). "A 570-kb DNA sequence of the Escherichia coli K-12 genome corresponding to the 28.0-40.1 min region on the linkage map." DNA Res 3:363-377. Pubmed: 9097039
  • Blattner, F. R., Plunkett, G. 3rd, Bloch, C. A., Perna, N. T., Burland, V., Riley, M., Collado-Vides, J., Glasner, J. D., Rode, C. K., Mayhew, G. F., Gregor, J., Davis, N. W., Kirkpatrick, H. A., Goeden, M. A., Rose, D. J., Mau, B., Shao, Y. (1997). "The complete genome sequence of Escherichia coli K-12." Science 277:1453-1462. Pubmed: 9278503
  • Bunch, P. K., Mat-Jan, F., Lee, N., Clark, D. P. (1997). "The ldhA gene encoding the fermentative lactate dehydrogenase of Escherichia coli." Microbiology 143 ( Pt 1):187-195. Pubmed: 9025293
  • Hayashi, K., Morooka, N., Yamamoto, Y., Fujita, K., Isono, K., Choi, S., Ohtsubo, E., Baba, T., Wanner, B. L., Mori, H., Horiuchi, T. (2006). "Highly accurate genome sequences of Escherichia coli K-12 strains MG1655 and W3110." Mol Syst Biol 2:2006.0007. Pubmed: 16738553