Identification
Name:4-hydroxy-2-oxovalerate aldolase
Synonyms:
  • HOA
  • 4-hydroxy-2-keto-pentanoic acid aldolase
  • 4-hydroxy-2-oxopentanoate aldolase
Gene Name:mhpE
Enzyme Class:
Biological Properties
General Function:Involved in 4-hydroxy-2-oxovalerate aldolase activity
Specific Function:Catalyzes the retro-aldol cleavage of 4-hydroxy-2- oxopentanoate to pyruvate and acetaldehyde. Is involved in the meta-cleavage pathway for the degradation of 3-phenylpropanoate
Cellular Location:Not Available
SMPDB Pathways:
KEGG Pathways:
KEGG Reactions:
ThumbThumb+Thumb
Thumb+ThumbThumb
Thumb+ThumbThumb
SMPDB Reactions:
4-hydroxy-2-oxopentanoate+ThumbThumb+Thumb
EcoCyc Reactions:
ThumbThumb+Thumb
Thumb+ThumbThumb
ThumbThumb+Thumb
Complex Reactions:
ThumbThumb+Thumb
Metabolites:
ECMDB IDNameView
ECMDB200894-Hydroxy-2-oxohexanoic acidMetaboCard
ECMDB200904-Hydroxy-2-oxopentanoateMetaboCard
ECMDB00990AcetaldehydeMetaboCard
ECMDB21277PropanalMetaboCard
ECMDB00243Pyruvic acidMetaboCard
GO Classification:
Function
4-hydroxy-2-oxovalerate aldolase activity
carbon-carbon lyase activity
catalytic activity
lyase activity
oxo-acid-lyase activity
Process
aromatic compound catabolic process
cellular aromatic compound metabolic process
cellular metabolic process
metabolic process
Gene Properties
Blattner:b0352
Gene OrientationClockwise
Centisome Percentage:8.04
Left Sequence End373092
Right Sequence End374105
Gene Sequence:
>1014 bp
ATGAACGGTAAAAAACTTTATATCTCGGACGTCACATTGCGTGACGGTATGCACGCCATT
CGTCATCAGTATTCGCTGGAAAACGTTCGCCAGATTGCCAAAGCACTGGACGATGCCCGC
GTGGATTCGATTGAAGTGGCCCACGGCGACGGTTTGCAAGGTTCCAGCTTTAACTATGGT
TTCGGCGCACATAGCGACCTTGAATGGATTGAAGCGGCGGCGGATGTGGTGAAGCACGCC
AAAATCGCGACGTTGTTGCTGCCAGGAATCGGCACTATTCACGATCTGAAAAATGCCTGG
CAGGCTGGCGCGCGGGTGGTTCGTGTGGCAACGCACTGTACCGAAGCTGATGTTTCCGCC
CAGCATATTCAGTATGCCCGCGAGCTCGGAATGGACACCGTTGGTTTTCTGATGATGAGC
CATATGACCACGCCGGAGAATCTCGCCAAGCAGGCAAAGCTGATGGAAGGCTACGGTGCG
ACCTGTATTTATGTGGTGGATTCTGGCGGTGCGATGAACATGAGCGATATCCGTGACCGT
TTCCGCGCCCTGAAAGCAGAGCTGAAACCAGAAACGCAAACTGGCATGCACGCTCACCAT
AACCTGAGTCTTGGCGTGGCGAACTCTATCGCGGCGGTGGAAGAGGGCTGCGACCGAATC
GACGCCAGCCTCGCGGGAATGGGCGCGGGCGCAGGTAACGCACCGCTGGAAGTGTTTATT
GCCGCCGCGGATAAACTGGGCTGGCAGCATGGGACCGATCTCTATGCGTTAATGGATGCC
GCCGACGACCTGGTGCGTCCGTTGCAGGATCGACCGGTACGAGTCGATCGCGAAACGCTG
GCGCTGGGATACGCTGGTGTTTACTCGAGCTTCCTGCGTCACTGTGAAACGGCGGCGGCG
CGTTATGGCTTAAGTGCGGTGGATATTCTCGTTGAGCTGGGCAAACGCCGGATGGTTGGC
GGCCAGGAGGATATGATCGTTGACGTGGCGCTGGATCTGCGCAACAACAAATAA
Protein Properties
Pfam Domain Function:
Protein Residues:337
Protein Molecular Weight:36470
Protein Theoretical pI:6
Signaling Regions:
  • None
Transmembrane Regions:
  • None
Protein Sequence:
>4-hydroxy-2-oxovalerate aldolase
MNGKKLYISDVTLRDGMHAIRHQYSLENVRQIAKALDDARVDSIEVAHGDGLQGSSFNYG
FGAHSDLEWIEAAADVVKHAKIATLLLPGIGTIHDLKNAWQAGARVVRVATHCTEADVSA
QHIQYARELGMDTVGFLMMSHMTTPENLAKQAKLMEGYGATCIYVVDSGGAMNMSDIRDR
FRALKAELKPETQTGMHAHHNLSLGVANSIAAVEEGCDRIDASLAGMGAGAGNAPLEVFI
AAADKLGWQHGTDLYALMDAADDLVRPLQDRPVRVDRETLALGYAGVYSSFLRHCETAAA
RYGLSAVDILVELGKRRMVGGQEDMIVDVALDLRNNK
References
External Links:
ResourceLink
Uniprot ID:P51020
Uniprot Name:HOA_ECOLI
GenBank Gene ID:AP009048
Genebank Protein ID:85674494
Ecogene ID:EG13292
Ecocyc:EG13292
ColiBase:b0352
Kegg Gene:b0352
EchoBASE ID:EB3077
CCDB:HOA_ECOLI
BacMap:16128337
General Reference:
  • Blattner, F. R., Plunkett, G. 3rd, Bloch, C. A., Perna, N. T., Burland, V., Riley, M., Collado-Vides, J., Glasner, J. D., Rode, C. K., Mayhew, G. F., Gregor, J., Davis, N. W., Kirkpatrick, H. A., Goeden, M. A., Rose, D. J., Mau, B., Shao, Y. (1997). "The complete genome sequence of Escherichia coli K-12." Science 277:1453-1462. Pubmed: 9278503
  • Hayashi, K., Morooka, N., Yamamoto, Y., Fujita, K., Isono, K., Choi, S., Ohtsubo, E., Baba, T., Wanner, B. L., Mori, H., Horiuchi, T. (2006). "Highly accurate genome sequences of Escherichia coli K-12 strains MG1655 and W3110." Mol Syst Biol 2:2006.0007. Pubmed: 16738553
  • Lee, S. J., Ko, J. H., Kang, H. Y., Lee, Y. (2006). "Coupled expression of MhpE aldolase and MhpF dehydrogenase in Escherichia coli." Biochem Biophys Res Commun 346:1009-1015. Pubmed: 16782065
  • Pollard, J. R., Rialland, D., Bugg, T. D. (1998). "Substrate selectivity and biochemical properties of 4-hydroxy-2-keto-pentanoic acid aldolase from Escherichia coli." Appl Environ Microbiol 64:4093-4094. Pubmed: 9758851