Identification
Name:Putative N-acetylgalactosamine-6-phosphate deacetylase
Synonyms:Not Available
Gene Name:agaA
Enzyme Class:Not Available
Biological Properties
General Function:Involved in hydrolase activity
Specific Function:N-acetyl-D-galactosamine 6-phosphate + H(2)O = D-galactosamine 6-phosphate + acetate
Cellular Location:Cytoplasmic
SMPDB Pathways:Not Available
KEGG Pathways:Not Available
Complex Reactions:
Thumb+ThumbThumb+Thumb
Metabolites:
ECMDB IDNameView
ECMDB00042Acetic acidMetaboCard
ECMDB20141D-Galactosamine 6-phosphateMetaboCard
ECMDB20175N-Acetyl-D-galactosamine 6-phosphateMetaboCard
ECMDB00494WaterMetaboCard
GO Classification:
Function
catalytic activity
hydrolase activity
Gene Properties
Blattner:b3135
Gene OrientationNot Available
Centisome Percentage:Not Available
Left Sequence EndNot Available
Right Sequence EndNot Available
Gene Sequence:
>504 bp
ATGCCGGGCAACAGCCCGCATTATGGGCGTTGGCCTCAACACGATTTTCCGCCATTTAAA
AAACTCAGGCCGCAGTCGGTAACCTCGCGCATACAGCCGGGCAGTGACGTCATCGTCTGC
GCGGAAATGGACGAACAGTGGGGATACGTCGGGGCTAAATCGCGCCAGCGCTGGCTGTTT
TACGCGTATGACAGGCTCCGGAAGACGGTTGTTGCGCACGTATTCGGTGAACGCACTATG
GCGACGCTGGGGCGTCTTATGAGCCTGCTGTCACCCTTTGACGTGGTGATATGGATGACG
GATGGCTGGCCGCTGTATGAATCCCGCCTGAAGGGAAAGCTGCACGTAATCAGCAAGCGA
TATACGCAGCGAATTGAGCGGTATAACCTGAATCTGAGGCAGCACCTGGCACGGCTGGGA
CGGAAGTCGCTGTCGTTCTCAAAATCGGTGGAGCTGCATGACAAAGTCATCGGGCATTAT
CTGAACATAAAACACTATCAATAA
Protein Properties
Pfam Domain Function:
Protein Residues:167
Protein Molecular Weight:17519
Protein Theoretical pI:7
Signaling Regions:
  • None
Transmembrane Regions:
  • None
Protein Sequence:
>Putative N-acetylgalactosamine-6-phosphate deacetylase
MHCYNGMTGLHHREPGMVGAGLTDKRAWLELIADGHHVHPAAMSLCCCCAKERIVLITDA
MQAAGMPDGRYTLCGEEVQMHGGVVRTASGGLAGSTLSVDAAVRNMVELTGVTPAEAIHM
ASLHPARMLGVDGVLGSLKPGKRASVVALDSGLHVQQIWIQGQLASF
References
External Links:
ResourceLink
Uniprot ID:P42906
Uniprot Name:AGAA_ECOLI
GenBank Gene ID:AP009048
Genebank Protein ID:1651483
ColiBase:b3135
Kegg Gene:b3135
EchoBASE ID:EB2619
CCDB:AGAA_ECOLI
General Reference:
  • Blattner, F. R., Plunkett, G. 3rd, Bloch, C. A., Perna, N. T., Burland, V., Riley, M., Collado-Vides, J., Glasner, J. D., Rode, C. K., Mayhew, G. F., Gregor, J., Davis, N. W., Kirkpatrick, H. A., Goeden, M. A., Rose, D. J., Mau, B., Shao, Y. (1997). "The complete genome sequence of Escherichia coli K-12." Science 277:1453-1462. Pubmed: 9278503
  • Hayashi, K., Morooka, N., Yamamoto, Y., Fujita, K., Isono, K., Choi, S., Ohtsubo, E., Baba, T., Wanner, B. L., Mori, H., Horiuchi, T. (2006). "Highly accurate genome sequences of Escherichia coli K-12 strains MG1655 and W3110." Mol Syst Biol 2:2006.0007. Pubmed: 16738553
  • Reizer, J., Ramseier, T. M., Reizer, A., Charbit, A., Saier, M. H. Jr (1996). "Novel phosphotransferase genes revealed by bacterial genome sequencing: a gene cluster encoding a putative N-acetylgalactosamine metabolic pathway in Escherichia coli." Microbiology 142 ( Pt 2):231-250. Pubmed: 8932697
  • Riley, M., Abe, T., Arnaud, M. B., Berlyn, M. K., Blattner, F. R., Chaudhuri, R. R., Glasner, J. D., Horiuchi, T., Keseler, I. M., Kosuge, T., Mori, H., Perna, N. T., Plunkett, G. 3rd, Rudd, K. E., Serres, M. H., Thomas, G. H., Thomson, N. R., Wishart, D., Wanner, B. L. (2006). "Escherichia coli K-12: a cooperatively developed annotation snapshot--2005." Nucleic Acids Res 34:1-9. Pubmed: 16397293