Identification
Name:Keto-acid formate acetyltransferase
Synonyms:
  • Keto-acid formate-lyase
Gene Name:tdcE
Enzyme Class:
Biological Properties
General Function:Involved in formate C-acetyltransferase activity
Specific Function:Specific function unknown
Cellular Location:Cytoplasm
SMPDB Pathways:
KEGG Pathways:
KEGG Reactions:
Thumb+ThumbThumb+Thumb
Thumb+ThumbThumb+Thumb
Thumb+ThumbThumb+Thumb
Thumb+ThumbThumb+Thumb
SMPDB Reactions:
Thumb+ThumbThumb+Propionyl-CoA+Thumb
EcoCyc Reactions:
Thumb+ThumbThumb+Thumb
Thumb+ThumbThumb+Thumb
Metabolites:
ECMDB IDNameView
ECMDB000052-Ketobutyric acidMetaboCard
ECMDB01206Acetyl-CoAMetaboCard
ECMDB01423Coenzyme AMetaboCard
ECMDB00142Formic acidMetaboCard
ECMDB01275Propionyl-CoAMetaboCard
ECMDB00243Pyruvic acidMetaboCard
GO Classification:
Component
cell part
cytoplasm
intracellular part
Function
acetyltransferase activity
acyltransferase activity
C-acetyltransferase activity
catalytic activity
formate C-acetyltransferase activity
transferase activity
transferase activity, transferring acyl groups
transferase activity, transferring acyl groups other than amino-acyl groups
Process
alcohol metabolic process
carbohydrate metabolic process
glucose metabolic process
hexose metabolic process
metabolic process
monosaccharide metabolic process
primary metabolic process
small molecule metabolic process
Gene Properties
Blattner:b3114
Gene OrientationCounterclockwise
Centisome Percentage:70.22
Left Sequence End3258146
Right Sequence End3260440
Gene Sequence:
>2295 bp
ATGAAGGTAGATATTGATACCAGCGATAAGCTGTACGCCGACGCATGGCTTGGCTTTAAA
GGTACGGACTGGAAAAACGAAATTAATGTCCGCGATTTTATTCAACATAACTATACACCG
TATGAAGGCGATGAATCTTTCCTCGCCGAAGCGACGCCTGCCACCACGGAATTGTGGGAA
AAAGTAATGGAAGGCATCCGTATCGAAAATGCAACCCACGCGCCGGTTGATTTCGATACC
AATATTGCCACCACAATTACCGCTCATGATGCGGGATATATTAACCAGCCGCTGGAAAAA
ATTGTTGGCCTGCAAACGGATGCGCCGTTGAAACGTGCGCTACACCCGTTCGGTGGCATT
AATATGATTAAAAGTTCATTCCACGCCTATGGCCGAGAAATGGACAGTGAATTTGAATAT
CTGTTTACCGATCTGCGTAAAACCCATAACCAGGGCGTATTTGATGTTTACTCACCGGAT
ATGCTGCGCTGCCGTAAATCTGGCGTGCTGACCGGTTTACCAGATGGCTATGGCCGTGGG
CGCATTATCGGTGACTATCGCCGCGTAGCGCTGTATGGCATCAGTTATCTGGTACGTGAA
CGCGAACTGCAATTTGCCGATCTCCAGTCTCGTCTGGAAAAAGGCGAGGATCTGGAAGCC
ACCATCCGTCTGCGTGAGGAGCTGGCAGAGCATCGTCATGCGCTGTTGCAGATTCAGGAA
ATGGCGGCGAAATATGGCTTTGATATCTCTCGCCCGGCGCAGAATGCGCAGGAAGCGGTG
CAGTGGCTCTACTTCGCTTATCTGGCGGCAGTGAAATCGCAAAATGGCGGCGCGATGTCG
CTGGGCCGCACGGCATCGTTCCTCGATATCTACATTGAGCGCGACTTTAAAGCTGGCGTA
CTCAATGAGCAGCAGGCACAGGAACTGATCGATCACTTCATCATGAAGATCCGTATGGTA
CGCTTCCTGCGTACACCGGAATTTGATTCGCTGTTCTCCGGCGACCCAATCTGGGCGACG
GAAGTGATCGGCGGGATGGGGCTGGACGGTCGTACGCTGGTGACCAAAAACTCCTTCCGC
TATTTGCACACCCTGCACACTATGGGGCCGGCACCGGAACCTAACCTGACCATTCTTTGG
TCGGAAGAATTACCGATTGCCTTCAAAAAATATGCCGCGCAGGTGTCGATCGTCACCTCT
TCCTTGCAGTATGAAAATGACGATCTGATGCGTACTGACTTCAACAGCGACGATTACGCG
ATTGCCTGCTGCGTCAGCCCAATGGTGATTGGTAAGCAAATGCAGTTCTTTGGTGCACGC
GCTAACCTGGCGAAAACGCTGCTCTACGCAATTAACGGCGGGGTGGACGAGAAGCTGAAG
ATTCAGGTCGGGCCGAAAACAGCACCGCTGATGGACGACGTGCTGGATTACGACAAAGTG
ATGGACAGCCTCGATCACTTCATGGACTGGCTGGCGGTGCAGTACATCAGCGCGCTGAAT
ATCATTCACTACATGCACGACAAGTACAGCTACGAAGCTTCGCTGATGGCGCTGCACGAT
CGTGATGTCTATCGCACTATGGCATGCGGCATCGCGGGCCTGTCGGTGGCGACGGACTCC
CTGTCTGCCATCAAATATGCCCGCGTGAAACCAATCCGTGACGAAAACGGCCTGGCGGTG
GACTTTGAAATCGACGGTGAATATCCGCAGTACGGCAACAACGACGAGCGCGTAGACAGC
ATTGCCTGCGACCTGGTTGAACGCTTTATGAAGAAAATTAAAGCGCTGCCAACCTATCGC
AACGCCGTCCCTACCCAGTCGATTCTGACTATCACTTCTAACGTGGTGTACGGCCAGAAA
ACCGGTAATACGCCGGACGGTCGTCGCGCCGGAACACCGTTCGCGCCGGGCGCTAACCCG
ATGCATGGTCGTGACCGCAAAGGTGCCGTGGCCTCATTGACGTCGGTGGCGAAACTGCCG
TTCACCTACGCCAAAGATGGGATCTCGTACACCTTCTCAATCGTTCCTGCGGCGCTGGGC
AAAGAAGATCCAGTACGTAAAACCAACCTTGTCGGCCTGCTGGATGGGTATTTCCACCAC
GAAGCGGATGTCGAAGGCGGTCAACACCTCAACGTCAACGTAATGAATCGGGAAATGCTG
CTGGATGCCATCGAGCACCCGGAAAAATATCCTAACCTGACAATCCGTGTCTCTGGCTAC
GCCGTGCGCTTCAACGCACTGACCCGTGAACAGCAACAGGATGTTATTTCACGTACCTTT
ACCCAGGCGCTCTGA
Protein Properties
Pfam Domain Function:
Protein Residues:764
Protein Molecular Weight:85935
Protein Theoretical pI:6
Signaling Regions:
  • None
Transmembrane Regions:
  • None
Protein Sequence:
>Keto-acid formate acetyltransferase
MKVDIDTSDKLYADAWLGFKGTDWKNEINVRDFIQHNYTPYEGDESFLAEATPATTELWE
KVMEGIRIENATHAPVDFDTNIATTITAHDAGYINQPLEKIVGLQTDAPLKRALHPFGGI
NMIKSSFHAYGREMDSEFEYLFTDLRKTHNQGVFDVYSPDMLRCRKSGVLTGLPDGYGRG
RIIGDYRRVALYGISYLVRERELQFADLQSRLEKGEDLEATIRLREELAEHRHALLQIQE
MAAKYGFDISRPAQNAQEAVQWLYFAYLAAVKSQNGGAMSLGRTASFLDIYIERDFKAGV
LNEQQAQELIDHFIMKIRMVRFLRTPEFDSLFSGDPIWATEVIGGMGLDGRTLVTKNSFR
YLHTLHTMGPAPEPNLTILWSEELPIAFKKYAAQVSIVTSSLQYENDDLMRTDFNSDDYA
IACCVSPMVIGKQMQFFGARANLAKTLLYAINGGVDEKLKIQVGPKTAPLMDDVLDYDKV
MDSLDHFMDWLAVQYISALNIIHYMHDKYSYEASLMALHDRDVYRTMACGIAGLSVATDS
LSAIKYARVKPIRDENGLAVDFEIDGEYPQYGNNDERVDSIACDLVERFMKKIKALPTYR
NAVPTQSILTITSNVVYGQKTGNTPDGRRAGTPFAPGANPMHGRDRKGAVASLTSVAKLP
FTYAKDGISYTFSIVPAALGKEDPVRKTNLVGLLDGYFHHEADVEGGQHLNVNVMNREML
LDAIEHPEKYPNLTIRVSGYAVRFNALTREQQQDVISRTFTQAL
References
External Links:
ResourceLink
Uniprot ID:P42632
Uniprot Name:TDCE_ECOLI
GenBank Gene ID:AP009048
Genebank Protein ID:85675912
Ecogene ID:EG12758
Ecocyc:EG12758
ColiBase:b3114
Kegg Gene:b3114
EchoBASE ID:EB2612
CCDB:TDCE_ECOLI
BacMap:49176316
General Reference:
  • Blattner, F. R., Plunkett, G. 3rd, Bloch, C. A., Perna, N. T., Burland, V., Riley, M., Collado-Vides, J., Glasner, J. D., Rode, C. K., Mayhew, G. F., Gregor, J., Davis, N. W., Kirkpatrick, H. A., Goeden, M. A., Rose, D. J., Mau, B., Shao, Y. (1997). "The complete genome sequence of Escherichia coli K-12." Science 277:1453-1462. Pubmed: 9278503
  • Hayashi, K., Morooka, N., Yamamoto, Y., Fujita, K., Isono, K., Choi, S., Ohtsubo, E., Baba, T., Wanner, B. L., Mori, H., Horiuchi, T. (2006). "Highly accurate genome sequences of Escherichia coli K-12 strains MG1655 and W3110." Mol Syst Biol 2:2006.0007. Pubmed: 16738553
  • Hesslinger, C., Fairhurst, S. A., Sawers, G. (1998). "Novel keto acid formate-lyase and propionate kinase enzymes are components of an anaerobic pathway in Escherichia coli that degrades L-threonine to propionate." Mol Microbiol 27:477-492. Pubmed: 9484901
  • Riley, M., Abe, T., Arnaud, M. B., Berlyn, M. K., Blattner, F. R., Chaudhuri, R. R., Glasner, J. D., Horiuchi, T., Keseler, I. M., Kosuge, T., Mori, H., Perna, N. T., Plunkett, G. 3rd, Rudd, K. E., Serres, M. H., Thomas, G. H., Thomson, N. R., Wishart, D., Wanner, B. L. (2006). "Escherichia coli K-12: a cooperatively developed annotation snapshot--2005." Nucleic Acids Res 34:1-9. Pubmed: 16397293