Canmetcon
Identification
Name:Gamma-glutamylputrescine oxidoreductase
Synonyms:
  • Gamma-Glu-Put oxidase
  • Gamma-glutamylputrescine oxidase
Gene Name:puuB
Enzyme Class:Not Available
Biological Properties
General Function:Involved in oxidoreductase activity
Specific Function:Involved in the breakdown of putrescine via the oxidation of L-glutamylputrescine
Cellular Location:Not Available
SMPDB Pathways:
KEGG Pathways:
  • Arginine and proline metabolism ec00330
KEGG Reactions:
Thumb+Thumb+ThumbThumb+Thumb+Thumb
SMPDB Reactions:
Thumb+Thumb+ThumbThumb+Thumb+Thumb
Thumb+Thumb+ThumbThumb+Thumb+Thumb
EcoCyc Reactions:
Thumb+Thumb+ThumbThumb+Thumb+Thumb
Thumb+Thumb+ThumbThumb+Thumb+Thumb
Metabolites:
ECMDB IDNameView
ECMDB241924-(γ-glutamylamino)butanalMetaboCard
ECMDB00051AmmoniaMetaboCard
ECMDB21186AmmoniumMetaboCard
ECMDB21337gamma-Glutamyl-gamma-butyraldehydeMetaboCard
ECMDB12230gamma-Glutamyl-L-putrescineMetaboCard
ECMDB21225Hydrogen ionMetaboCard
ECMDB21232Hydrogen peroxideMetaboCard
ECMDB04124OxygenMetaboCard
ECMDB00494WaterMetaboCard
GO Classification:
Function
catalytic activity
oxidoreductase activity
Gene Properties
Blattner:b1301
Gene OrientationClockwise
Centisome Percentage:29.36
Left Sequence End1362256
Right Sequence End1363536
Gene Sequence:
>1281 bp
ATGACCGAACATACCAGCAGTTACTACGCCGCCAGTGCGAATAAATATGCACCATTCGAC
ACGCTGAATGAGTCAATCACCTGCGACGTTTGCGTGGTTGGCGGCGGCTATACCGGGCTC
TCCTCCGCGCTGCATCTGGCGGAAGCGGGCTTTGACGTAGTGGTTCTCGAAGCCTCACGC
ATCGGCTTTGGCGCAAGCGGGCGCAATGGCGGACAGCTTGTGAACTCCTACAGCCGCGAC
ATCGACGTGATCGAAAAAAGCTACGGCATGGACACCGCCCGTATGCTCGGCAGCATGATG
TTCGAAGGTGGTGAGATCATCCGCGAACGTATCAAACGTTATCAGATTGACTGCGACTAC
CGCCCCGGCGGCCTGTTTGTGGCGATGAATGATAAACAGCTCGCCACACTTGAAGAGCAG
AAAGAGAACTGGGAACGCTACGGCAATAAACAGCTGGAATTGCTGGACGCCAACGCCATT
CGCCGTGAAGTAGCCAGCGATCGCTATACCGGTGCGCTGCTGGATCACAGCGGTGGGCAT
ATTCATCCGCTAAACCTTGCCATTGGCGAAGCGGACGCCATCCGCCTCAACGGCGGGCGC
GTGTATGAACTTTCTGCCGTGACGCAGATCCAGCACACCACGCCAGCCGTTGTGCGAACT
GCCAAAGGTCAGGTGACGGCGAAGTATGTGATTGTCGCCGGGAATGCGTATCTGGGCGAT
AAAGTAGAGCCGGAACTGGCGAAACGCAGCATGCCGTGCGGCACGCAGGTGATCACCACC
GAACGGCTGTCGGAAGATTTAGCCCGTTCGCTGATCCCGAAAAACTACTGTGTGGAAGAC
TGTAACTATCTGCTTGATTACTACCGTCTTACCGCCGACAACCGCCTGCTGTACGGCGGC
GGCGTGGTCTACGGCGCGCGCGACCCGGATGACGTTGAGCGCCTTGTGGTGCCGAAACTG
CTGAAAACCTTCCCGCAGCTGAAGGGCGTGAAAATTGATTACCGCTGGACGGGCAACTTC
CTGCTGACCCTGTCGCGTATGCCGCAGTTTGGTCGCCTCGATACCAACATCTATTACATG
CAGGGCTACAGCGGCCACGGCGTGACCTGTACTCATCTAGCCGGACGTTTGATTGCCGAA
CTGCTGCGCGGCGACGCCGAACGTTTCGATGCCTTCGCCAATCTGCCGCATTACCCGTTC
CCCGGCGGGCGCACGCTGCGTGTGCCGTTTACCGCGATGGGCGCGGCGTATTACAGCCTG
CGCGATCGTCTGGGCGTTTAA
Protein Properties
Pfam Domain Function:
Protein Residues:426
Protein Molecular Weight:47169
Protein Theoretical pI:7
Signaling Regions:
  • None
Transmembrane Regions:
  • None
Protein Sequence:
>Gamma-glutamylputrescine oxidoreductase
MTEHTSSYYAASANKYAPFDTLNESITCDVCVVGGGYTGLSSALHLAEAGFDVVVLEASR
IGFGASGRNGGQLVNSYSRDIDVIEKSYGMDTARMLGSMMFEGGEIIRERIKRYQIDCDY
RPGGLFVAMNDKQLATLEEQKENWERYGNKQLELLDANAIRREVASDRYTGALLDHSGGH
IHPLNLAIGEADAIRLNGGRVYELSAVTQIQHTTPAVVRTAKGQVTAKYVIVAGNAYLGD
KVEPELAKRSMPCGTQVITTERLSEDLARSLIPKNYCVEDCNYLLDYYRLTADNRLLYGG
GVVYGARDPDDVERLVVPKLLKTFPQLKGVKIDYRWTGNFLLTLSRMPQFGRLDTNIYYM
QGYSGHGVTCTHLAGRLIAELLRGDAERFDAFANLPHYPFPGGRTLRVPFTAMGAAYYSL
RDRLGV
References
External Links:
ResourceLink
Uniprot ID:P37906
Uniprot Name:PUUB_ECOLI
GenBank Gene ID:AB200320
Genebank Protein ID:58197519
Ecogene ID:EG11822
Ecocyc:EG11822
ColiBase:b1301
Kegg Gene:b1301
EchoBASE ID:EB1769
CCDB:PUUB_ECOLI
BacMap:16129262
General Reference:
  • Aiba, H., Baba, T., Hayashi, K., Inada, T., Isono, K., Itoh, T., Kasai, H., Kashimoto, K., Kimura, S., Kitakawa, M., Kitagawa, M., Makino, K., Miki, T., Mizobuchi, K., Mori, H., Mori, T., Motomura, K., Nakade, S., Nakamura, Y., Nashimoto, H., Nishio, Y., Oshima, T., Saito, N., Sampei, G., Horiuchi, T., et, a. l. .. (1996). "A 570-kb DNA sequence of the Escherichia coli K-12 genome corresponding to the 28.0-40.1 min region on the linkage map." DNA Res 3:363-377. Pubmed: 9097039
  • Blattner, F. R., Plunkett, G. 3rd, Bloch, C. A., Perna, N. T., Burland, V., Riley, M., Collado-Vides, J., Glasner, J. D., Rode, C. K., Mayhew, G. F., Gregor, J., Davis, N. W., Kirkpatrick, H. A., Goeden, M. A., Rose, D. J., Mau, B., Shao, Y. (1997). "The complete genome sequence of Escherichia coli K-12." Science 277:1453-1462. Pubmed: 9278503
  • Borodovsky, M., Rudd, K. E., Koonin, E. V. (1994). "Intrinsic and extrinsic approaches for detecting genes in a bacterial genome." Nucleic Acids Res 22:4756-4767. Pubmed: 7984428
  • Hayashi, K., Morooka, N., Yamamoto, Y., Fujita, K., Isono, K., Choi, S., Ohtsubo, E., Baba, T., Wanner, B. L., Mori, H., Horiuchi, T. (2006). "Highly accurate genome sequences of Escherichia coli K-12 strains MG1655 and W3110." Mol Syst Biol 2:2006.0007. Pubmed: 16738553
  • Heim, R., Strehler, E. E. (1991). "Cloning an Escherichia coli gene encoding a protein remarkably similar to mammalian aldehyde dehydrogenases." Gene 99:15-23. Pubmed: 1840553
  • Kurihara, S., Oda, S., Kato, K., Kim, H. G., Koyanagi, T., Kumagai, H., Suzuki, H. (2005). "A novel putrescine utilization pathway involves gamma-glutamylated intermediates of Escherichia coli K-12." J Biol Chem 280:4602-4608. Pubmed: 15590624