Identification
Name:Aldehyde dehydrogenase B
Synonyms:Not Available
Gene Name:aldB
Enzyme Class:Not Available
Biological Properties
General Function:Involved in oxidoreductase activity
Specific Function:Catalyzes the NADP-dependent oxidation of diverse aldehydes such as chloroacetaldehyde, acetaldehyde, propionaldehyde, benzaldehyde, mafosfamide, 4- hydroperoxycyclophosphamide. Its preferred substrates are acetaldehyde and chloroacetaldehyde
Cellular Location:Not Available
SMPDB Pathways:Not Available
KEGG Pathways:
EcoCyc Reactions:
Thumb+Thumb+ThumbThumb+2 Thumb+Thumb
Complex Reactions:
Thumb+Thumb+Thumb2 Thumb+Thumb+Thumb
Metabolites:
ECMDB IDNameView
ECMDB00990AcetaldehydeMetaboCard
ECMDB00042Acetic acidMetaboCard
ECMDB21225Hydrogen ionMetaboCard
ECMDB00217NADPMetaboCard
ECMDB04111NADPHMetaboCard
ECMDB21277PropanalMetaboCard
ECMDB00237Propionic acidMetaboCard
ECMDB00494WaterMetaboCard
GO Classification:
Function
catalytic activity
oxidoreductase activity
Process
metabolic process
oxidation reduction
Gene Properties
Blattner:b3588
Gene OrientationCounterclockwise
Centisome Percentage:80.89
Left Sequence End3752996
Right Sequence End3754534
Gene Sequence:
>1539 bp
ATGGCAAGAGCTGTACACCGTAGTGGGTTAGTGGCGCTGGGCATTGCGACAGCGTTGATG
GCATCTTGTGCATTCGCTGCCAAAGATGTGGTGGTGGCGGTAGGATCGAATTTCACCACG
CTCGATCCGTATGACGCAAATGACACGTTATCTCAGGCCGTAGCGAAATCGTTTTACCAG
GGGCTGTTCGGTCTGGATAAAGAGATGAAACTGAAAAACGTGCTGGCGGAGAGTTATACC
GTTTCCGATGACGGCATTACTTACACCGTGAAATTGCGGGAAGGCATTAAATTCCAGGAT
GGCACCGATTTCAACGCCGCGGCGGTGAAAGCGAATCTGGACCGGGCCAGCGATCCGGCG
AATCATCTTAAACGCTATAACCTGTATAAGAATATTGCTAAAACGGAAGCGATCGATCCG
ACAACGGTAAAGATTACCCTCAAACAGCCGTTCTCAGCGTTTATTAATATTCTTGCCCAT
CCGGCGACCGCGATGATTTCACCGGCAGCGCTGGAAAAATATGGCAAGGAGATTGGTTTT
TATCCGGTGGGAACCGGACCGTATGAACTGGATACCTGGAATCAGACCGATTTTGTGAAG
GTGAAAAAATTCGCGGGTTACTGGCAGCCAGGATTGCCCAAACTGGACAGCATAACCTGG
CGTCCGGTGGCGGATAACAACACCCGCGCGGCAATGCTGCAAACCGGTGAAGCGCAGTTT
GCTTTCCCCATTCCTTACGAGCAGGCCACACTGCTGGAGAAAAACAAAAATATCGAGTTG
ATGGCCAGTCCGTCAATTATGCAGCGTTATATCAGTATGAACGTGACGCAAAAGCCGTTC
GATAACCCGAAGGTCCGTGAGGCGCTGAATTACGCCATTAACCGTCCGGCGCTGGTGAAA
GTTGCCTTTGCGGGCTATGCAACGCCAGCTACTGGTGTGGTACCGCCAAGTATCGCCTAC
GCGCAAAGTTATAAACCGTGGCCTTACGATCCAGTGAAAGCGCGCGAATTACTGAAAGAG
GCGGGATATCCCAACGGTTTCAGTACCACGCTGTGGTCGTCACATAACCACAGCACCGCG
CAGAAAGTGCTGCAATTTACCCAGCAGCAGTTAGCGCAGGTCGGGATTAAAGCCCAGGTG
ACTGCGATGGATGCCGGACAGCGGGCGGCAGAAGTTGAAGGTAAAGGGCAAAAAGAGAGC
GGCGTGCGGATGTTCTACACTGGCTGGTCGGCTTCAACCGGCGAAGCGGACTGGGCACTA
TCGCCGCTGTTTGCCTCGCAGAACTGGCCACCGACGCTGTTTAATACCGCGTTTTACAGC
AATAAACAGGTGGATGACTTCCTGGCTCAGGCACTGAAAACTAATGATCCGGCGGAAAAG
ACCCGCTTATATAAGGCGGCGCAGGATATCATCTGGCAAGAATCGCCGTGGATCCCGCTG
GTGGTAGAAAAACTGGTGTCGGCACACAGTAAAAACCTGACCGGTTTTTGGATCATGCCA
GACACCGGCTTCAGCTTTGAAGACGCGGATTTGCAATAA
Protein Properties
Pfam Domain Function:
Protein Residues:512
Protein Molecular Weight:56306
Protein Theoretical pI:5
Signaling Regions:
  • None
Transmembrane Regions:
  • None
Protein Sequence:
>Aldehyde dehydrogenase B
MTNNPPSAQIKPGEYGFPLKLKARYDNFIGGEWVAPADGEYYQNLTPVTGQLLCEVASSG
KRDIDLALDAAHKVKDKWAHTSVQDRAAILFKIADRMEQNLELLATAETWDNGKPIRETS
AADVPLAIDHFRYFASCIRAQEGGISEVDSETVAYHFHEPLGVVGQIIPWNFPLLMASWK
MAPALAAGNCVVLKPARLTPLSVLLLMEIVGDLLPPGVVNVVNGAGGVIGEYLATSKRIA
KVAFTGSTEVGQQIMQYATQNIIPVTLELGGKSPNIFFADVMDEEDAFFDKALEGFALFA
FNQGEVCTCPSRALVQESIYERFMERAIRRVESIRSGNPLDSVTQMGAQVSHGQLETILN
YIDIGKKEGADVLTGGRRKLLEGELKDGYYLEPTILFGQNNMRVFQEEIFGPVLAVTTFK
TMEEALELANDTQYGLGAGVWSRNGNLAYKMGRGIQAGRVWTNCYHAYPAHAAFGGYKQS
GIGRETHKMMLEHYQQTKCLLVSYSDKPLGLF
References
External Links:
ResourceLink
Uniprot ID:P37685
Uniprot Name:ALDB_ECOLI
GenBank Gene ID:AP009048
Genebank Protein ID:85674773
Ecogene ID:EG12292
Ecocyc:EG12292
ColiBase:b3588
Kegg Gene:b3588
EchoBASE ID:EB2200
CCDB:ALDB_ECOLI
BacMap:90111619
General Reference:
  • Blattner, F. R., Plunkett, G. 3rd, Bloch, C. A., Perna, N. T., Burland, V., Riley, M., Collado-Vides, J., Glasner, J. D., Rode, C. K., Mayhew, G. F., Gregor, J., Davis, N. W., Kirkpatrick, H. A., Goeden, M. A., Rose, D. J., Mau, B., Shao, Y. (1997). "The complete genome sequence of Escherichia coli K-12." Science 277:1453-1462. Pubmed: 9278503
  • Hayashi, K., Morooka, N., Yamamoto, Y., Fujita, K., Isono, K., Choi, S., Ohtsubo, E., Baba, T., Wanner, B. L., Mori, H., Horiuchi, T. (2006). "Highly accurate genome sequences of Escherichia coli K-12 strains MG1655 and W3110." Mol Syst Biol 2:2006.0007. Pubmed: 16738553
  • Ho, K. K., Weiner, H. (2005). "Isolation and characterization of an aldehyde dehydrogenase encoded by the aldB gene of Escherichia coli." J Bacteriol 187:1067-1073. Pubmed: 15659684
  • Sofia, H. J., Burland, V., Daniels, D. L., Plunkett, G. 3rd, Blattner, F. R. (1994). "Analysis of the Escherichia coli genome. V. DNA sequence of the region from 76.0 to 81.5 minutes." Nucleic Acids Res 22:2576-2586. Pubmed: 8041620
  • Xu, J., Johnson, R. C. (1995). "aldB, an RpoS-dependent gene in Escherichia coli encoding an aldehyde dehydrogenase that is repressed by Fis and activated by Crp." J Bacteriol 177:3166-3175. Pubmed: 7768815