Identification
Name:NADH-quinone oxidoreductase subunit L
Synonyms:
  • NADH dehydrogenase I subunit L
  • NDH-1 subunit L
  • NUO12
Gene Name:nuoL
Enzyme Class:
Biological Properties
General Function:Involved in NADH dehydrogenase (ubiquinone) activity
Specific Function:NDH-1 shuttles electrons from NADH, via FMN and iron- sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient
Cellular Location:Cell inner membrane; Multi-pass membrane protein
SMPDB Pathways:
KEGG Pathways:
KEGG Reactions:
Thumb+AcceptorThumb+Reduced acceptor
Ubiquinol-8 + Acceptor ↔ Ubiquinone-1 + Reduced acceptor
ReactionCard
Thumb+ThumbThumb+Thumb
SMPDB Reactions:
Thumb+5 Thumb+ThumbThumb+Thumb+Thumb
Thumb+4 Thumb+2 Thumb+menaquinone-8 ? Thumb+Thumb+Thumb+Electron+4 Thumb
"a menaquinone"+4 Thumb+Thumb"a menaquinol"+Thumb
"a menaquinone" + 4 Hydrogen ion + NADH → "a menaquinol" + NAD
ReactionCard
4 Thumb+Thumb+"a menaquinone"Thumb+"a menaquinol"
4 Hydrogen ion + NADH + "a menaquinone" → NAD + "a menaquinol"
ReactionCard
Complex Reactions:
Thumb+4 Thumb+ThumbThumb+Thumb+3 Thumb
4 Thumb+Thumb+ThumbThumb+Thumb+3 Thumb
4 Thumb+Menaquinone 8+ThumbThumb+Thumb+3 Thumb
Thumb+ThumbThumb+Thumb
Thumb+ThumbThumb+Thumb
Thumb+ThumbThumb+Thumb
Metabolites:
ECMDB IDNameView
ECMDB211542-Demethylmenaquinol 8MetaboCard
ECMDB211552-Demethylmenaquinone 8MetaboCard
ECMDB21225Hydrogen ionMetaboCard
ECMDB02434HydroquinoneMetaboCard
ECMDB21245Menaquinol 8MetaboCard
ECMDB00902NADMetaboCard
ECMDB01487NADHMetaboCard
ECMDB23060QuinoneMetaboCard
ECMDB21574Ubiquinol-1MetaboCard
ECMDB01060Ubiquinol-8MetaboCard
ECMDB21438Ubiquinone-1MetaboCard
ECMDB21296Ubiquinone-8MetaboCard
GO Classification:
Function
catalytic activity
NADH dehydrogenase (quinone) activity
NADH dehydrogenase (ubiquinone) activity
NADH dehydrogenase activity
oxidoreductase activity
oxidoreductase activity, acting on NADH or NADPH
Process
ATP synthesis coupled electron transport
cellular metabolic process
electron transport chain
generation of precursor metabolites and energy
metabolic process
oxidation reduction
respiratory electron transport chain
Gene Properties
Blattner:b2278
Gene OrientationCounterclockwise
Centisome Percentage:51.54
Left Sequence End2391227
Right Sequence End2393068
Gene Sequence:
>1842 bp
ATGAACATGCTTGCCTTAACCATTATTTTGCCATTGATTGGCTTCGTCCTGCTGGCATTC
TCCCGTGGGCGCTGGTCTGAAAACGTCTCGGCGATCGTCGGCGTAGGCTCTGTGGGCCTG
GCGGCGCTGGTAACCGCCTTTATCGGCGTTGATTTCTTCGCTAACGGCGAGCAGACATAC
AGCCAGCCGCTGTGGACGTGGATGTCGGTAGGCGACTTTAACATCGGTTTTAACCTGGTG
CTGGACGGCCTGTCGCTGACCATGCTCTCGGTGGTCACTGGTGTGGGTTTCCTTATTCAC
ATGTACGCCTCCTGGTATATGCGCGGTGAAGAGGGCTACTCTCGCTTCTTCGCTTACACC
AACCTGTTCATCGCCAGCATGGTGGTTCTGGTGCTTGCCGACAACCTGCTGCTGATGTAC
CTCGGCTGGGAAGGCGTGGGCCTGTGCTCCTATCTGCTGATCGGGTTCTATTACACCGAT
CCGAAGAATGGCGCAGCGGCAATGAAAGCGTTCGTCGTGACCCGTGTGGGTGACGTGTTC
CTCGCTTTCGCACTGTTCATTCTTTACAACGAACTGGGCACCCTGAACTTCCGCGAAATG
GTGGAACTGGCACCAGCGCACTTTGCTGACGGCAATAACATGCTGATGTGGGCGACGCTG
ATGCTGCTGGGCGGTGCGGTCGGTAAATCTGCGCAGTTGCCGTTGCAGACATGGCTTGCC
GACGCGATGGCGGGCCCGACGCCTGTCTCCGCGCTGATCCACGCCGCAACCATGGTAACC
GCGGGTGTCTACCTGATCGCCCGTACCCACGGCCTGTTCCTGATGACGCCGGAAGTTCTG
CATCTGGTGGGTATTGTCGGGGCGGTTACGCTGCTGCTGGCCGGTTTTGCCGCGCTGGTA
CAGACCGACATCAAACGTGTTCTCGCTTACTCTACCATGAGCCAGATTGGCTACATGTTC
CTCGCGCTTGGCGTGCAGGCATGGGATGCGGCGATTTTCCACTTGATGACCCACGCGTTC
TTTAAAGCGCTGCTGTTCCTGGCATCCGGTTCCGTCATTCTGGCCTGCCATCACGAACAG
AACATCTTCAAGATGGGCGGTCTGCGTAAATCTATTCCGCTGGTTTATCTCTGCTTCCTG
GTGGGCGGCGCAGCACTGTCGGCACTACCGCTGGTCACTGCGGGCTTCTTCAGTAAGGAT
GAGATCCTCGCGGGTGCGATGGCGAATGGTCATATCAATCTGATGGTGGCAGGTCTGGTC
GGTGCGTTTATGACCTCGCTCTACACCTTCCGTATGATTTTCATCGTCTTCCACGGAAAA
GAACAAATTCACGCTCACGCCGTGAAAGGGGTAACTCACAGCCTGCCGCTGATTGTGCTG
CTGATCCTTTCCACCTTCGTTGGCGCACTGATTGTACCGCCGCTGCAGGGCGTGCTTCCG
CAAACGACGGAACTGGCGCACGGCAGCATGTTGACCCTGGAAATTACCTCTGGCGTGGTC
GCGGTGGTCGGCATTCTGCTGGCAGCCTGGCTGTGGCTGGGTAAACGTACTCTGGTGACC
TCCATCGCCAACAGTGCGCCGGGCCGTCTGCTGGGCACCTGGTGGTACAACGCCTGGGGA
TTTGACTGGCTGTATGACAAAGTGTTCGTCAAGCCGTTCCTGGGTATTGCCTGGTTGCTG
AAACGCGATCCGCTGAACTCAATGATGAACATCCCGGCTGTCCTTTCCCGCTTTGCAGGT
AAAGGTCTGCTGTTAAGTGAGAACGGCTATCTGCGCTGGTATGTGGCATCCATGAGCATC
GGTGCGGTCGTGGTGCTGGCACTGTTGATGGTACTGCGTTGA
Protein Properties
Pfam Domain Function:
Protein Residues:613
Protein Molecular Weight:66438
Protein Theoretical pI:8
Signaling Regions:
  • None
Transmembrane Regions:
  • 7-23
  • 32-52
  • 75-99
  • 116-133
  • 211-228
  • 249-267
  • 282-300
  • 307-325
  • 339-356
  • 374-397
  • 414-437
  • 455-472
  • 495-514
  • 590-607
Protein Sequence:
>NADH-quinone oxidoreductase subunit L
MNMLALTIILPLIGFVLLAFSRGRWSENVSAIVGVGSVGLAALVTAFIGVDFFANGEQTY
SQPLWTWMSVGDFNIGFNLVLDGLSLTMLSVVTGVGFLIHMYASWYMRGEEGYSRFFAYT
NLFIASMVVLVLADNLLLMYLGWEGVGLCSYLLIGFYYTDPKNGAAAMKAFVVTRVGDVF
LAFALFILYNELGTLNFREMVELAPAHFADGNNMLMWATLMLLGGAVGKSAQLPLQTWLA
DAMAGPTPVSALIHAATMVTAGVYLIARTHGLFLMTPEVLHLVGIVGAVTLLLAGFAALV
QTDIKRVLAYSTMSQIGYMFLALGVQAWDAAIFHLMTHAFFKALLFLASGSVILACHHEQ
NIFKMGGLRKSIPLVYLCFLVGGAALSALPLVTAGFFSKDEILAGAMANGHINLMVAGLV
GAFMTSLYTFRMIFIVFHGKEQIHAHAVKGVTHSLPLIVLLILSTFVGALIVPPLQGVLP
QTTELAHGSMLTLEITSGVVAVVGILLAAWLWLGKRTLVTSIANSAPGRLLGTWWYNAWG
FDWLYDKVFVKPFLGIAWLLKRDPLNSMMNIPAVLSRFAGKGLLLSENGYLRWYVASMSI
GAVVVLALLMVLR
References
External Links:
ResourceLink
Uniprot ID:P33607
Uniprot Name:NUOL_ECOLI
GenBank Gene ID:AP009048
Genebank Protein ID:1799638
Ecogene ID:EG12092
Ecocyc:EG12092
ColiBase:b2278
Kegg Gene:b2278
EchoBASE ID:EB2016
CCDB:NUOL_ECOLI
BacMap:16130213
General Reference:
  • Blattner, F. R., Plunkett, G. 3rd, Bloch, C. A., Perna, N. T., Burland, V., Riley, M., Collado-Vides, J., Glasner, J. D., Rode, C. K., Mayhew, G. F., Gregor, J., Davis, N. W., Kirkpatrick, H. A., Goeden, M. A., Rose, D. J., Mau, B., Shao, Y. (1997). "The complete genome sequence of Escherichia coli K-12." Science 277:1453-1462. Pubmed: 9278503
  • Daley, D. O., Rapp, M., Granseth, E., Melen, K., Drew, D., von Heijne, G. (2005). "Global topology analysis of the Escherichia coli inner membrane proteome." Science 308:1321-1323. Pubmed: 15919996
  • Hayashi, K., Morooka, N., Yamamoto, Y., Fujita, K., Isono, K., Choi, S., Ohtsubo, E., Baba, T., Wanner, B. L., Mori, H., Horiuchi, T. (2006). "Highly accurate genome sequences of Escherichia coli K-12 strains MG1655 and W3110." Mol Syst Biol 2:2006.0007. Pubmed: 16738553
  • Weidner, U., Geier, S., Ptock, A., Friedrich, T., Leif, H., Weiss, H. (1993). "The gene locus of the proton-translocating NADH: ubiquinone oxidoreductase in Escherichia coli. Organization of the 14 genes and relationship between the derived proteins and subunits of mitochondrial complex I." J Mol Biol 233:109-122. Pubmed: 7690854
  • Yamamoto, Y., Aiba, H., Baba, T., Hayashi, K., Inada, T., Isono, K., Itoh, T., Kimura, S., Kitagawa, M., Makino, K., Miki, T., Mitsuhashi, N., Mizobuchi, K., Mori, H., Nakade, S., Nakamura, Y., Nashimoto, H., Oshima, T., Oyama, S., Saito, N., Sampei, G., Satoh, Y., Sivasundaram, S., Tagami, H., Horiuchi, T., et, a. l. .. (1997). "Construction of a contiguous 874-kb sequence of the Escherichia coli -K12 genome corresponding to 50.0-68.8 min on the linkage map and analysis of its sequence features." DNA Res 4:91-113. Pubmed: 9205837