Identification
Name:Pyrimidine-specific ribonucleoside hydrolase rihB
Synonyms:
  • Cytidine/uridine-specific hydrolase
Gene Name:rihB
Enzyme Class:
Biological Properties
General Function:Involved in hydrolase activity, hydrolyzing N-glycosyl compounds
Specific Function:Hydrolyzes cytidine or uridine to ribose and cytosine or uracil, respectively. Has a clear preference for cytidine over uridine. Strictly specific for ribonucleosides. Has a low but significant activity for the purine nucleoside xanthosine
Cellular Location:Cytoplasmic
SMPDB Pathways:
KEGG Pathways:
KEGG Reactions:
Thumb+ThumbThumb+Thumb
Thumb+ThumbThumb+Thumb
Thumb+ThumbThumb+Thumb
Thumb+ThumbThumb+Thumb
Thumb+ThumbThumb+Thumb
Thumb+ThumbThumb+Thumb
Thumb+ThumbThumb+Thumb
Thumb+ThumbThumb+Thumb
Complex Reactions:
Thumb+ThumbThumb+Thumb
A pyrimidine nucleoside+ThumbThumb+a pyrimidine base
A pyrimidine nucleoside + WaterRibose + a pyrimidine base
ReactionCard
Metabolites:
ECMDB IDNameView
ECMDB00034AdenineMetaboCard
ECMDB00050AdenosineMetaboCard
ECMDB00089CytidineMetaboCard
ECMDB00630CytosineMetaboCard
ECMDB00132GuanineMetaboCard
ECMDB00133GuanosineMetaboCard
ECMDB00157HypoxanthineMetaboCard
ECMDB00195InosineMetaboCard
ECMDB00283RiboseMetaboCard
ECMDB00300UracilMetaboCard
ECMDB00296UridineMetaboCard
ECMDB00494WaterMetaboCard
GO Classification:
Function
catalytic activity
hydrolase activity
hydrolase activity, acting on glycosyl bonds
hydrolase activity, hydrolyzing N-glycosyl compounds
Gene Properties
Blattner:b2162
Gene OrientationCounterclockwise
Centisome Percentage:48.54
Left Sequence End2252267
Right Sequence End2253208
Gene Sequence:
>942 bp
ATGAAGCTGATACGCGGCATACATAATCTCAGCCAGGCCCCGCAAGAAGGGTGTGTGCTG
ACTATTGGTAATTTCGACGGCGTGCATCGCGGTCATCGCGCGCTGTTACAGGGCTTGCAG
GAAGAAGGGCGCAAGCGCAACTTACCGGTGATGGTGATGCTTTTTGAACCTCAACCACTG
GAACTGTTTGCTACCGATAAAGCCCCGGCAAGACTGACCCGGCTGCGGGAAAAACTGCGT
TACCTTGCAGAGTGTGGCGTTGATTACGTGCTGTGCGTGCGTTTCGACAGGCGTTTCGCG
GCGTTAACCGCGCAAAATTTCATCAGCGATCTTCTGGTGAAGCATTTGCGCGTAAAATTT
CTTGCCGTAGGTGATGATTTCCGCTTTGGCGCTGGTCGTGAAGGCGATTTCTTGTTATTA
CAGAAAGCTGGCATGGAATACGGCTTCGATATCACCAGTACGCAAACTTTTTGCGAAGGT
GGCGTGCGCATCAGCAGCACCGCCGTGCGTCAGGCCCTTGCGGATGACAATCTGGCTCTG
GCAGAGAGTTTACTGGGGCACCCGTTTGCCATCTCCGGGCGTGTAGTCCACGGTGATGAA
TTAGGGCGCACTATAGGTTTCCCGACGGCGAATGTACCGCTGCGCCGTCAGGTTTCCCCG
GTGAAAGGGGTTTATGCGGTAGAAGTGCTGGGCCTCGGTGAAAAGCCGTTACCCGGCGTG
GCAAACATCGGAACACGCCCAACGGTTGCCGGTATTCGCCAGCAGCTGGAAGTGCATTTG
TTAGATGTTGCAATGGACCTTTACGGTCGCCATATACAAGTAGTGCTGCGTAAAAAAATA
CGCAATGAGCAGCGATTTGCGTCGCTGGACGAACTGAAAGCGCAGATTGCGCGTGATGAA
TTAACCGCCCGCGAATTTTTTGGGCTAACAAAACCGGCTTAA
Protein Properties
Pfam Domain Function:
Protein Residues:313
Protein Molecular Weight:33748
Protein Theoretical pI:4
PDB File:1Q8F
Signaling Regions:
  • None
Transmembrane Regions:
  • None
Protein Sequence:
>Pyrimidine-specific ribonucleoside hydrolase rihB
MEKRKIILDCDPGHDDAIAIMMAAKHPAIDLLGITIVAGNQTLDKTLINGLNVCQKLEIN
VPVYAGMPQPIMRQQIVADNIHGETGLDGPVFEPLTRQAESTHAVKYIIDTLMASDGDIT
LVPVGPLSNIAVAMRMQPAILPKIREIVLMGGAYGTGNFTPSAEFNIFADPEAARVVFTS
GVPLVMMGLDLTNQTVCTPDVIARMERAGGPAGELFSDIMNFTLKTQFENYGLAGGPVHD
ATCIGYLINPDGIKTQEMYVEVDVNSGPCYGRTVCDELGVLGKPANTKVGITIDTDWFWG
LVEECVRGYIKTH
References
External Links:
ResourceLink
Uniprot ID:P33022
Uniprot Name:RIHB_ECOLI
GenBank Gene ID:AP009048
Genebank Protein ID:85674289
PDB ID:1Q8F
Ecogene ID:EG12030
Ecocyc:EG12030
ColiBase:b2162
Kegg Gene:b2162
EchoBASE ID:EB1965
CCDB:RIHB_ECOLI
BacMap:16130100
General Reference:
  • Blattner, F. R., Plunkett, G. 3rd, Bloch, C. A., Perna, N. T., Burland, V., Riley, M., Collado-Vides, J., Glasner, J. D., Rode, C. K., Mayhew, G. F., Gregor, J., Davis, N. W., Kirkpatrick, H. A., Goeden, M. A., Rose, D. J., Mau, B., Shao, Y. (1997). "The complete genome sequence of Escherichia coli K-12." Science 277:1453-1462. Pubmed: 9278503
  • Giabbai, B., Degano, M. (2004). "Crystal structure to 1.7 a of the Escherichia coli pyrimidine nucleoside hydrolase YeiK, a novel candidate for cancer gene therapy." Structure 12:739-749. Pubmed: 15130467
  • Hayashi, K., Morooka, N., Yamamoto, Y., Fujita, K., Isono, K., Choi, S., Ohtsubo, E., Baba, T., Wanner, B. L., Mori, H., Horiuchi, T. (2006). "Highly accurate genome sequences of Escherichia coli K-12 strains MG1655 and W3110." Mol Syst Biol 2:2006.0007. Pubmed: 16738553
  • Petersen, C., Moller, L. B. (2001). "The RihA, RihB, and RihC ribonucleoside hydrolases of Escherichia coli. Substrate specificity, gene expression, and regulation." J Biol Chem 276:884-894. Pubmed: 11027694