Identification
Name:Pyruvate formate-lyase 2-activating enzyme
Synonyms:
  • Formate-C-acetyltransferase-activating enzyme 2
  • PFL-activating enzyme 2
Gene Name:pflC
Enzyme Class:
Biological Properties
General Function:Involved in iron-sulfur cluster binding
Specific Function:Activation of pyruvate formate-lyase 2 under anaerobic conditions by generation of an organic free radical, using S- adenosylmethionine and reduced flavodoxin as cosubstrates to produce 5'-deoxy-adenosine
Cellular Location:Cytoplasm
SMPDB Pathways:Not Available
KEGG Pathways:Not Available
KEGG Reactions:
Thumb+ThumbThumb+Thumb
EcoCyc Reactions:
Thumb+ThumbThumb+Thumb
Metabolites:
ECMDB IDNameView
ECMDB211745'-DeoxyadenosineMetaboCard
ECMDB01206Acetyl-CoAMetaboCard
ECMDB01423Coenzyme AMetaboCard
ECMDB00142Formic acidMetaboCard
ECMDB00696L-MethionineMetaboCard
ECMDB00243Pyruvic acidMetaboCard
ECMDB01185S-AdenosylmethionineMetaboCard
GO Classification:
Component
cell part
cytoplasm
intracellular part
Function
4 iron, 4 sulfur cluster binding
binding
catalytic activity
iron-sulfur cluster binding
metal cluster binding
oxidoreductase activity
Process
alcohol metabolic process
cellular metabolic process
glucose metabolic process
hexose metabolic process
metabolic process
monosaccharide metabolic process
oxidation reduction
oxygen and reactive oxygen species metabolic process
small molecule metabolic process
Gene Properties
Blattner:b3952
Gene OrientationClockwise
Centisome Percentage:89.32
Left Sequence End4144281
Right Sequence End4145159
Gene Sequence:
>879 bp
ATGGCTGAAGCGCAAAATGATCCCCTGCTGCCGGGATACTCGTTTAACGCCCATCTGGTG
GCGGGTTTAACGCCGATTGAGGCCAACGGTTATCTCGATTTTTTTATCGACCGACCGCTG
GGAATGAAAGGTTATATTCTCAATCTCACCATTCGCGGTCAGGGGGTGGTGAAAAATCAG
GGACGAGAATTTGTCTGCCGACCGGGTGATATTTTGCTGTTCCCGCCAGGAGAGATTCAT
CACTACGGTCGTCATCCGGAGGCTCGCGAATGGTATCACCAGTGGGTTTACTTTCGTCCG
CGCGCCTACTGGCATGAATGGCTTAACTGGCCGTCAATATTTGCCAATACGGGTTTCTTT
CGCCCGGATGAAGCGCACCAGCCGCATTTCAGCGACCTGTTTGGGCAAATCATTAACGCC
GGGCAAGGGGAAGGGCGCTATTCGGAGCTGCTGGCGATAAATCTGCTTGAGCAATTGTTA
CTGCGGCGCATGGAAGCGATTAACGAGTCGCTCCATCCACCGATGGATAATCGGGTACGC
GAGGCTTGTCAGTACATCAGCGATCACCTGGCAGACAGCAATTTTGATATCGCCAGCGTC
GCACAGCATGTTTGCTTGTCGCCGTCGCGTCTGTCACATCTTTTCCGCCAGCAGTTAGGG
ATTAGCGTCTTAAGCTGGCGCGAGGACCAACGCATTAGTCAGGCGAAGCTGCTTTTGAGC
ACTACCCGGATGCCTATCGCCACCGTCGGTCGCAATGTTGGTTTTGACGATCAACTCTAT
TTCTCGCGAGTATTTAAAAAATGCACCGGGGCCAGCCCGAGCGAGTTTCGTGCCGGTTGT
GAAGAAAAAGTGAATGATGTAGCCGTCAAGTTGTCATAA
Protein Properties
Pfam Domain Function:
Protein Residues:292
Protein Molecular Weight:32429
Protein Theoretical pI:8
Signaling Regions:
  • None
Transmembrane Regions:
  • None
Protein Sequence:
>Pyruvate formate-lyase 2-activating enzyme
MTSSAGQRISCNVVETRRDDVARIFNIQRYSLNDGEGIRTVVFFKGCPHLCPWCANPESI
SGKIQTVRREAKCLHCAKCLRDADECPSGAFERIGRDISLDALEREVMKDDIFFRTSGGG
VTLSGGEVLMQAEFATRFLQRLRLWGVSCAIETAGDAPASKLLPLAKLCDEVLFDLKIMD
ATQARDVVKMNLPRVLENLRLLVSEGVNVIPRLPLIPGFTLSRENMQQALDVLIPLNIRQ
IHLLPFHQYGEPKYRLLGKTWSMKEVPAPSSADVATMREMAERAGLQVTVGG
References
External Links:
ResourceLink
Uniprot ID:P32675
Uniprot Name:PFLC_ECOLI
GenBank Gene ID:AP009048
Genebank Protein ID:21321946
Ecogene ID:EG11911
Ecocyc:EG11911
ColiBase:b3952
Kegg Gene:b3952
EchoBASE ID:EB1855
CCDB:PFLC_ECOLI
BacMap:49176447
General Reference:
  • Blattner, F. R., Burland, V., Plunkett, G. 3rd, Sofia, H. J., Daniels, D. L. (1993). "Analysis of the Escherichia coli genome. IV. DNA sequence of the region from 89.2 to 92.8 minutes." Nucleic Acids Res 21:5408-5417. Pubmed: 8265357
  • Blattner, F. R., Plunkett, G. 3rd, Bloch, C. A., Perna, N. T., Burland, V., Riley, M., Collado-Vides, J., Glasner, J. D., Rode, C. K., Mayhew, G. F., Gregor, J., Davis, N. W., Kirkpatrick, H. A., Goeden, M. A., Rose, D. J., Mau, B., Shao, Y. (1997). "The complete genome sequence of Escherichia coli K-12." Science 277:1453-1462. Pubmed: 9278503
  • Hayashi, K., Morooka, N., Yamamoto, Y., Fujita, K., Isono, K., Choi, S., Ohtsubo, E., Baba, T., Wanner, B. L., Mori, H., Horiuchi, T. (2006). "Highly accurate genome sequences of Escherichia coli K-12 strains MG1655 and W3110." Mol Syst Biol 2:2006.0007. Pubmed: 16738553
  • Reizer, J., Reizer, A., Saier, M. H. Jr (1995). "Novel phosphotransferase system genes revealed by bacterial genome analysis--a gene cluster encoding a unique Enzyme I and the proteins of a fructose-like permease system." Microbiology 141 ( Pt 4):961-971. Pubmed: 7773398