Identification
Name:Formate acetyltransferase 2
Synonyms:
  • Pyruvate formate-lyase 2
Gene Name:pflD
Enzyme Class:
Biological Properties
General Function:Involved in catalytic activity
Specific Function:Acetyl-CoA + formate = CoA + pyruvate
Cellular Location:Cytoplasm
SMPDB Pathways:
KEGG Pathways:
KEGG Reactions:
Thumb+ThumbThumb+Thumb
Thumb+ThumbThumb+Thumb
Thumb+ThumbThumb+Thumb
Thumb+ThumbThumb+Thumb
EcoCyc Reactions:
Thumb+ThumbThumb+Thumb
Thumb+ThumbThumb+Thumb
Metabolites:
ECMDB IDNameView
ECMDB000052-Ketobutyric acidMetaboCard
ECMDB01206Acetyl-CoAMetaboCard
ECMDB01423Coenzyme AMetaboCard
ECMDB00142Formic acidMetaboCard
ECMDB01275Propionyl-CoAMetaboCard
ECMDB00243Pyruvic acidMetaboCard
GO Classification:
Component
cell part
cytoplasm
intracellular part
Function
acetyltransferase activity
acyltransferase activity
C-acetyltransferase activity
catalytic activity
formate C-acetyltransferase activity
transferase activity
transferase activity, transferring acyl groups
transferase activity, transferring acyl groups other than amino-acyl groups
Process
alcohol metabolic process
glucose metabolic process
hexose metabolic process
metabolic process
monosaccharide metabolic process
small molecule metabolic process
Gene Properties
Blattner:b3951
Gene OrientationClockwise
Centisome Percentage:89.27
Left Sequence End4142018
Right Sequence End4144315
Gene Sequence:
>2298 bp
ATGACGAATCGTATCTCTCGCCTCAAAACTGCACTGTTTGCCAATACCCGTGAAATCTCG
CTGGAGCGGGCGCTGCTTTATACCGCCAGCCATCGGCAAACCGAAGGCGAACCGGTGATA
TTGCGCCGGGCGAAAGCAACAGCGTATATCCTTGAACATGTTGAAATTTCGATTCGTGAT
GAAGAACTGATTGCCGGTAACCGCACCGTAAAACCGCGCGCCGGGATTATGTCGCCGGAA
ATGGACCCTTACTGGCTGCTGAAAGAGCTGGATCAATTCCCGACGCGTCCGCAGGACCGC
TTTGCTATCAGCGAAGAAGATAAACGTATCTACCGTGAAGAGTTGTTCCCGTACTGGGAA
AAACGTTCGATGAAAGATTTCATCAACGGGCAGATGACAGATGAAGTAAAAGCCGCGACC
AACACGCAGATTTTCAGCATCAACCAGACGGATAAAGGCCAGGGGCACATTATTATTGAT
TACCCACGCCTGTTGAATCACGGGCTGGGTGAGCTGGTGGCACAGATGCAGCAACATTGT
CAGCAACAGCCGGAGAATCACTTTTATCAGGCCGCGTTGTTACTGCTGGAAGCCTCGCAG
AAACACATTTTGCGTTACGCCGAACTGGCGGAAACGATGGCGGCAAACTGCACAGATGCC
CAGCGTCGCGAAGAGCTGCTGACTATTGCAGAGATCTCCCGCCATAACGCGCAACATAAG
CCGCAGACGTTCTGGCAGGCGTGCCAGTTATTCTGGTACATGAACATCATTCTGCAATAC
GAATCCAACGCCAGTTCGCTATCGTTGGGGCGCTTCGACCAGTATATGTTGCCGTTCTAT
CAGACATCATTAACCCAGGGCGAAGATGCGGCGTTCCTGAAAGAACTGCTCGAATCTTTA
TGGGTGAAATGCAACGACATCGTGCTGTTGCGCTCCACCAGTAGCGCGCGTTATTTCGCC
GGTTTCCCGACCGGCTATACCGCACTGCTCGGCGGGTTAACCGAGAACGGACGTAGCGCG
GTGAACGTGCTTTCGTTCCTTTGCCTTGACGCCTATCAAAGCGTGCAATTACCGCAACCG
AACCTCGGCGTGCGCACTAACGCCTTGATCGACACGCCGTTCCTGATGAAAACCGCCGAA
ACCATTCGCTTCGGTACCGGTATTCCGCAAATCTTTAACGATGAAGTGGTGGTGCCAGCG
TTCCTCAACCGTGGCGTTTCGCTGGAAGATGCGCGCGACTATTCCGTAGTGGGCTGTGTG
GAATTATCTATTCCCGGCAGAACCTACGGCTTGCATGACATCGCGATGTTTAATCTGCTG
AAAGTGATGGAAATCTGCCTGCATGAAAATGAAGGCAATGCTGCGCTGACTTATGAAGGT
TTACTGGAGCAGATCCGCGCCAAGATCAGCCACTACATCACCCTGATGGTTGAGGGCAGC
AATATTTGTGATATCGGCCATCGCGACTGGGCACCTGTACCGCTGCTCTCATCGTTTATC
AGCGATTGTCTGGAAAAAGGCCGCGATATTACCGATGGCGGCGCGCGTTATAACTTCTCC
GGCGTACAGGGGATCGGTATCGCCAACCTGAGCGATTCTCTCCATGCGTTGAAAGGGATG
GTTTTTGAGCAACAGCGTTTAAGTTTTGACGAATTGCTGTCGGTATTAAAAGCCAACTTC
GCAACGCCAGAAGGCGAAAAAGTCCGCGCTCGCTTAATTAACCGCTTCGAGAAATACGGT
AACGATATCGACGAGGTGGATAACATCAGCGCCGAACTGTTGCGCCACTACTGCAAAGAA
GTGGAAAAATACCAGAACCCGCGCGGCGGCTACTTCACGCCGGGATCGTATACCGTTTCT
GCTCACGTCCCGTTGGGATCGGTGGTTGGCGCGACGCCAGACGGTCGTTTTGCCGGAGAA
CAGCTGGCAGACGGCGGCTTGTCACCCATGCTGGGCCAGGACGCACAAGGGCCAACAGCG
GTACTGAAGTCAGTCAGTAAGCTCGATAACACGCTGCTGTCTAACGGTACGTTGCTGAAC
GTGAAATTCACTCCGGCGACCCTGGAAGGTGAAGCAGGATTACGCAAACTGGCCGACTTC
TTACGGGCGTTTACCCAGCTTAAGTTACAACATATTCAGTTTAACGTGGTGAACGCCGAC
ACGTTGCGGGAAGCGCAACAGCGCCCACAAGATTATGCCGGGCTGGTGGTGCGCGTTGCC
GGATACAGCGCCTTCTTTGTCGAACTGTCGAAGGAGATCCAGGATGACATCATCCGCCGG
ACAGCGCATCAGCTGTAA
Protein Properties
Pfam Domain Function:
Protein Residues:765
Protein Molecular Weight:85959
Protein Theoretical pI:6
Signaling Regions:
  • None
Transmembrane Regions:
  • None
Protein Sequence:
>Formate acetyltransferase 2
MTNRISRLKTALFANTREISLERALLYTASHRQTEGEPVILRRAKATAYILEHVEISIRD
EELIAGNRTVKPRAGIMSPEMDPYWLLKELDQFPTRPQDRFAISEEDKRIYREELFPYWE
KRSMKDFINGQMTDEVKAATNTQIFSINQTDKGQGHIIIDYPRLLNHGLGELVAQMQQHC
QQQPENHFYQAALLLLEASQKHILRYAELAETMAANCTDAQRREELLTIAEISRHNAQHK
PQTFWQACQLFWYMNIILQYESNASSLSLGRFDQYMLPFYQTSLTQGEDAAFLKELLESL
WVKCNDIVLLRSTSSARYFAGFPTGYTALLGGLTENGRSAVNVLSFLCLDAYQSVQLPQP
NLGVRTNALIDTPFLMKTAETIRFGTGIPQIFNDEVVVPAFLNRGVSLEDARDYSVVGCV
ELSIPGRTYGLHDIAMFNLLKVMEICLHENEGNAALTYEGLLEQIRAKISHYITLMVEGS
NICDIGHRDWAPVPLLSSFISDCLEKGRDITDGGARYNFSGVQGIGIANLSDSLHALKGM
VFEQQRLSFDELLSVLKANFATPEGEKVRARLINRFEKYGNDIDEVDNISAELLRHYCKE
VEKYQNPRGGYFTPGSYTVSAHVPLGSVVGATPDGRFAGEQLADGGLSPMLGQDAQGPTA
VLKSVSKLDNTLLSNGTLLNVKFTPATLEGEAGLRKLADFLRAFTQLKLQHIQFNVVNAD
TLREAQQRPQDYAGLVVRVAGYSAFFVELSKEIQDDIIRRTAHQL
References
External Links:
ResourceLink
Uniprot ID:P32674
Uniprot Name:PFLD_ECOLI
GenBank Gene ID:AP009048
Genebank Protein ID:85676110
Ecogene ID:EG11910
Ecocyc:EG11910
ColiBase:b3951
Kegg Gene:b3951
EchoBASE ID:EB1854
CCDB:PFLD_ECOLI
BacMap:16131789
General Reference:
  • Blattner, F. R., Burland, V., Plunkett, G. 3rd, Sofia, H. J., Daniels, D. L. (1993). "Analysis of the Escherichia coli genome. IV. DNA sequence of the region from 89.2 to 92.8 minutes." Nucleic Acids Res 21:5408-5417. Pubmed: 8265357
  • Blattner, F. R., Plunkett, G. 3rd, Bloch, C. A., Perna, N. T., Burland, V., Riley, M., Collado-Vides, J., Glasner, J. D., Rode, C. K., Mayhew, G. F., Gregor, J., Davis, N. W., Kirkpatrick, H. A., Goeden, M. A., Rose, D. J., Mau, B., Shao, Y. (1997). "The complete genome sequence of Escherichia coli K-12." Science 277:1453-1462. Pubmed: 9278503
  • Hayashi, K., Morooka, N., Yamamoto, Y., Fujita, K., Isono, K., Choi, S., Ohtsubo, E., Baba, T., Wanner, B. L., Mori, H., Horiuchi, T. (2006). "Highly accurate genome sequences of Escherichia coli K-12 strains MG1655 and W3110." Mol Syst Biol 2:2006.0007. Pubmed: 16738553
  • Reizer, J., Reizer, A., Saier, M. H. Jr (1995). "Novel phosphotransferase system genes revealed by bacterial genome analysis--a gene cluster encoding a unique Enzyme I and the proteins of a fructose-like permease system." Microbiology 141 ( Pt 4):961-971. Pubmed: 7773398