Canmetcon
Identification
Name:L-serine dehydratase 2
Synonyms:
  • SDH 2
  • L-serine deaminase 2
  • L-SD2
Gene Name:sdaB
Enzyme Class:
Biological Properties
General Function:Involved in L-serine ammonia-lyase activity
Specific Function:Deaminates also threonine, particularly when it is present in high concentration
Cellular Location:Not Available
SMPDB Pathways:
KEGG Pathways:
KEGG Reactions:
ThumbThumb+Thumb
ThumbThumb+Thumb
ThumbThumb+Thumb
ThumbThumb+Thumb
Thumb+Thumb+Thumb+ThumbThumb+Thumb
SMPDB Reactions:
L-Serine+ThumbThumb+Thumb+Thumb
EcoCyc Reactions:
ThumbThumb+Thumb
ThumbThumb+Thumb+Thumb
ThumbThumb+Thumb
ThumbThumb+Thumb
Complex Reactions:
ThumbThumb+Thumb
Metabolites:
ECMDB IDNameView
ECMDB036092-Aminoacrylic acidMetaboCard
ECMDB00051AmmoniaMetaboCard
ECMDB21186AmmoniumMetaboCard
ECMDB21225Hydrogen ionMetaboCard
ECMDB00187L-SerineMetaboCard
ECMDB00243Pyruvic acidMetaboCard
ECMDB00494WaterMetaboCard
GO Classification:
Function
4 iron, 4 sulfur cluster binding
ammonia-lyase activity
binding
carbon-nitrogen lyase activity
catalytic activity
iron-sulfur cluster binding
L-serine ammonia-lyase activity
lyase activity
metal cluster binding
Process
alcohol metabolic process
gluconeogenesis
glucose metabolic process
hexose metabolic process
metabolic process
monosaccharide metabolic process
small molecule metabolic process
Gene Properties
Blattner:b2797
Gene OrientationClockwise
Centisome Percentage:63.10
Left Sequence End2927598
Right Sequence End2928965
Gene Sequence:
>1368 bp
ATGAGCACTAAATTAACCGGCTATGTATGGGATGGTTGCGCTGCATCAGGCATGAAGTTA
TCCAGCGTGGCAATTATGGCCCGCCTGGCTGATTTCAGTAATGACGAAGGTGTGTGCTGG
CCATCAATTGAAACCATTGCCCGTCAGATTGGCGCGGGGATGAGTACCGTCAGAACGGCT
ATCGCACGGCTGGAAGCAGAAGGCTGGTTAACGCGTAAGGCGCGTCGCCAGGGTGATGGT
TCATCACCCCACTGTGCCGTGGTGGATGAATATCACGAGCACGCCACAGATGCGCTTTAC
ACCACGATGCTTACCGGGATGGGGGCGCGACGCCAGCCACTGATGTGGGCCATTACCACC
GCCGGGTACAACATTGAGGGGCCGTGCTACGACAAACGGCGGGAAGTCATCGAGATGCTC
AACGGCTCGGTGCCAAACGATGAACTGTTCGGGATCATCTATACCGTTGATGAAGGTGAC
GACTGGACCGACCCGCAGGTGCTGGAAAAAGCCAATCCAAATATTGGCGTGTCGGTTTAT
CGCGAATTTTTGTTAAGTCAGCAGCAGCGTGCGAAAAATAACGCCCGTCTGGCAAACGTC
TTTAAAACAAAACACCTCAATATCTGGGCGTCGGCGCGTTCGGCGTATTTCAACCTGGTG
AGCTGGCAGAGCTGCGAGGATAAATCACTGACCCTTGAGCAGTTCGAGGGGCAGCCGTGC
ATTCTGGCCTTTGACCTGGCGCGTAAGCTGGATATGAACAGCATGGCGCGACTTTATACC
CGCGAGATTGACGGTAAAACGCATTACTACAGTGTGGCCCCGCGTTTCTGGGTACCGTAT
GACACGGTGTACAGCGTCGAGAAAAATGAAGATCGCCGGACAGCCGAACGCTTTCAGAAA
TGGGTGGAAATGGGCGTTCTGACCGTTACCGATGGTGCGGAGGTGGATTATCGCTACATC
CTCGAAGAGGCCAAAGCGGCGAACAAAATCAGCCCGGTCAGTGAGTCACCCATCGACCCC
TTCGGGGCGACCGGGCTGTCACATGACCTTGCTGATGAAGACCTGAACCCCGTCACCATC
ATTCAGAACTACACCAACATGTCCGATCCGATGAAAGAGCTGGAAGCGGCGATTGAATCG
GGGCGCTTTCATCATGACGGCAATCCCATCATGACCTGGTGTATCGGCAACGTGGTCGGC
AAAACCATTCCGGGTAACGATGATGTGGTGAAGCCCGTCAAGGAGCAGGCGGAAAACAAA
ATCGATGGTGCAGTTGCGCTGATTATGGCGGTTGGCAGAGCCATGCTGTACGAGAAAGAA
GACACGCTGTCTGATCACATTGAGTCCTACGGGATCCGCTCGCTTTAA
Protein Properties
Pfam Domain Function:
Protein Residues:455
Protein Molecular Weight:48753
Protein Theoretical pI:6
Signaling Regions:
  • None
Transmembrane Regions:
  • None
Protein Sequence:
>L-serine dehydratase 2
MISVFDIFKIGIGPSSSHTVGPMKAGKQFTDDLIARNLLKDVTRVVVDVYGSLSLTGKGH
HTDIAIIMGLAGNLPDTVDIDSIPSFIQDVNTHGRLMLANGQHEVEFPVDQCMNFHADNL
SLHENGMRITALAGDKVVYSQTYYSIGGGFIVDEEHFGQQDSAPVEVPYPYSSAADLQKH
CQETGLSLSGLMMKNELALHSKEELEQHLANVWEVMRGGIERGISTEGVLPGKLRVPRRA
AALRRMLVSQDKTTTDPMAVVDWINMFALAVNEENAAGGRVVTAPTNGACGIIPAVLAYY
DKFIREVNANSLARYLLVASAIGSLYKMNASISGAEVGCQGEVGVACSMAAAGLAELLGA
SPAQVCIAAEIAMEHNLGLTCDPVAGQVQVPCIERNAIAAVKAVNAARMALRRTSEPRVC
LDKVIETMYETGKDMNAKYRETSRGGLAMKIVACD
References
External Links:
ResourceLink
Uniprot ID:P30744
Uniprot Name:SDHM_ECOLI
GenBank Gene ID:AP009048
Genebank Protein ID:4062724
Ecogene ID:EG11623
Ecocyc:EG11623
ColiBase:b2797
Kegg Gene:b2797
EchoBASE ID:EB1580
CCDB:SDHM_ECOLI
BacMap:16130704
General Reference:
  • Blattner, F. R., Plunkett, G. 3rd, Bloch, C. A., Perna, N. T., Burland, V., Riley, M., Collado-Vides, J., Glasner, J. D., Rode, C. K., Mayhew, G. F., Gregor, J., Davis, N. W., Kirkpatrick, H. A., Goeden, M. A., Rose, D. J., Mau, B., Shao, Y. (1997). "The complete genome sequence of Escherichia coli K-12." Science 277:1453-1462. Pubmed: 9278503
  • Hayashi, K., Morooka, N., Yamamoto, Y., Fujita, K., Isono, K., Choi, S., Ohtsubo, E., Baba, T., Wanner, B. L., Mori, H., Horiuchi, T. (2006). "Highly accurate genome sequences of Escherichia coli K-12 strains MG1655 and W3110." Mol Syst Biol 2:2006.0007. Pubmed: 16738553
  • Shao, Z., Newman, E. B. (1993). "Sequencing and characterization of the sdaB gene from Escherichia coli K-12." Eur J Biochem 212:777-784. Pubmed: 8385012