Identification
Name:Protein sbm
Synonyms:Not Available
Gene Name:sbm
Enzyme Class:
Biological Properties
General Function:Involved in isomerase activity
Specific Function:Specific function unknown
Cellular Location:Not Available
SMPDB Pathways:
KEGG Pathways:
  • Glyoxylate and dicarboxylate metabolism ec00630
  • Metabolic pathways eco01100
  • Microbial metabolism in diverse environments ec01120
  • Propanoate metabolism ec00640
  • Reductive carboxylate cycle (CO2 fixation) ec00720
  • Valine, leucine and isoleucine degradation ec00280
KEGG Reactions:
ThumbThumb
SMPDB Reactions:
Succinyl-CoA+ThumbThumb
ThumbR-Methylmalonyl-CoA
Succinyl-CoA ↔ R-Methylmalonyl-CoA
ReactionCard
EcoCyc Reactions:
ThumbThumb
Complex Reactions:
ThumbThumb
Metabolites:
ECMDB IDNameView
ECMDB21641(R)-Methylmalonyl-CoAMetaboCard
ECMDB02310(S)-Methylmalonyl-CoAMetaboCard
ECMDB24063Methylmalonyl-CoAMetaboCard
ECMDB02255R-Methylmalonyl-CoAMetaboCard
ECMDB01022Succinyl-CoAMetaboCard
GO Classification:
Function
binding
catalytic activity
cation binding
cobalamin binding
intramolecular transferase activity
ion binding
isomerase activity
metal ion binding
methylmalonyl-CoA mutase activity
vitamin binding
Process
metabolic process
Gene Properties
Blattner:b2917
Gene OrientationClockwise
Centisome Percentage:65.93
Left Sequence End3058872
Right Sequence End3061016
Gene Sequence:
>2145 bp
GTGTCCCGTATTATTATGCTGATCCCTACCGGAACCAGCGTCGGTCTGACCAGCGTCAGC
CTTGGCGTGATCCGTGCAATGGAACGCAAAGGCGTTCGTCTGAGCGTTTTCAAACCTATC
GCTCAGCCGCGTACCGGTGGCGATGCGCCCGATCAGACTACGACTATCGTGCGTGCGAAC
TCTTCCACCACGACGGCCGCTGAACCGCTGAAAATGAGCTACGTTGAAGGTCTGCTTTCC
AGCAATCAGAAAGATGTGCTGATGGAAGAGATCGTCGCAAACTACCACGCTAACACCAAA
GACGCTGAAGTCGTTCTGGTTGAAGGTCTGGTCCCGACACGTAAGCACCAGTTTGCCCAG
TCTCTGAACTACGAAATCGCTAAAACGCTGAATGCGGAAATCGTCTTCGTTATGTCTCAG
GGCACTGACACCCCGGAACAGCTGAAAGAGCGTATCGAACTGACCCGCAACAGCTTCGGC
GGTGCCAAAAACACCAACATCACCGGCGTTATCGTTAACAAACTGAACGCACCGGTTGAT
GAACAGGGTCGTACTCGCCCGGATCTGTCCGAGATTTTCGACGACTCTTCCAAAGCTAAA
GTAAACAATGTTGATCCGGCGAAGCTGCAAGAATCCAGCCCGCTGCCGGTTCTCGGCGCT
GTGCCGTGGAGCTTTGACCTGATCGCGACTCGTGCGATCGATATGGCTCGCCACCTGAAT
GCGACCATCATCAACGAAGGCGACATCAATACTCGCCGCGTTAAATCCGTCACTTTCTGC
GCACGCAGCATTCCGCACATGCTGGAGCACTTCCGTGCCGGTTCTCTGCTGGTGACTTCC
GCAGACCGTCCTGACGTGCTGGTGGCCGCTTGCCTGGCAGCCATGAACGGCGTAGAAATC
GGTGCCCTGCTGCTGACTGGCGGTTACGAAATGGACGCGCGCATTTCTAAACTGTGCGAA
CGTGCTTTCGCTACCGGCCTGCCGGTATTTATGGTGAACACCAACACCTGGCAGACCTCT
CTGAGCCTGCAGAGCTTCAACCTGGAAGTTCCGGTTGACGATCACGAACGTATCGAGAAA
GTTCAGGAATACGTTGCTAACTACATCAACGCTGACTGGATCGAATCTCTGACTGCCACT
TCTGAGCGCAGCCGTCGTCTGTCTCCGCCTGCGTTCCGTTATCAGCTGACTGAACTTGCG
CGCAAAGCGGGCAAACGTATCGTACTGCCGGAAGGTGACGAACCGCGTACCGTTAAAGCA
GCCGCTATCTGTGCTGAACGTGGTATCGCAACTTGCGTACTGCTGGGTAATCCGGCAGAG
ATCAACCGTGTTGCAGCGTCTCAGGGTGTAGAACTGGGTGCAGGGATTGAAATCGTTGAT
CCAGAAGTGGTTCGCGAAAGCTATGTTGGTCGTCTGGTCGAACTGCGTAAGAACAAAGGC
ATGACCGAAACCGTTGCCCGCGAACAGCTGGAAGACAACGTGGTGCTCGGTACGCTGATG
CTGGAACAGGATGAAGTTGATGGTCTGGTTTCCGGTGCTGTTCACACTACCGCAAACACC
ATCCGTCCGCCGCTGCAGCTGATCAAAACTGCACCGGGCAGCTCCCTGGTATCTTCCGTG
TTCTTCATGCTGCTGCCGGAACAGGTTTACGTTTACGGTGACTGTGCGATCAACCCGGAT
CCGACCGCTGAACAGCTGGCAGAAATCGCGATTCAGTCCGCTGATTCCGCTGCGGCCTTC
GGTATCGAACCGCGCGTTGCTATGCTCTCCTACTCCACCGGTACTTCTGGTGCAGGTAGC
GACGTAGAAAAAGTTCGCGAAGCAACTCGTCTGGCGCAGGAAAAACGTCCTGACCTGATG
ATCGACGGTCCGCTGCAGTACGACGCTGCGGTAATGGCTGACGTTGCGAAATCCAAAGCG
CCGAACTCTCCGGTTGCAGGTCGCGCTACCGTGTTCATCTTCCCGGATCTGAACACCGGT
AACACCACCTACAAAGCGGTACAGCGTTCTGCCGACCTGATCTCCATCGGGCCGATGCTG
CAGGGTATGCGCAAGCCGGTTAACGACCTGTCCCGTGGCGCACTGGTTGACGATATCGTC
TACACCATCGCGCTGACTGCGATTCAGTCTGCACAGCAGCAGTAA
Protein Properties
Pfam Domain Function:
Protein Residues:714
Protein Molecular Weight:77871
Protein Theoretical pI:5
Signaling Regions:
  • None
Transmembrane Regions:
  • None
Protein Sequence:
>Protein sbm
MSNVQEWQQLANKELSRREKTVDSLVHQTAEGIAIKPLYTEADLDNLEVTGTLPGLPPYV
RGPRATMYTAQPWTIRQYAGFSTAKESNAFYRRNLAAGQKGLSVAFDLATHRGYDSDNPR
VAGDVGKAGVAIDTVEDMKVLFDQIPLDKMSVSMTMNGAVLPVLAFYIVAAEEQGVTPDK
LTGTIQNDILKEYLCRNTYIYPPKPSMRIIADIIAWCSGNMPRFNTISISGYHMGEAGAN
CVQQVAFTLADGIEYIKAAISAGLKIDDFAPRLSFFFGIGMDLFMNVAMLRAARYLWSEA
VSGFGAQDPKSLALRTHCQTSGWSLTEQDPYNNVIRTTIEALAATLGGTQSLHTNAFDEA
LGLPTDFSARIARNTQIIIQEESELCRTVDPLAGSYYIESLTDQIVKQARAIIQQIDEAG
GMAKAIEAGLPKRMIEEASAREQSLIDQGKRVIVGVNKYKLDHEDETDVLEIDNVMVRNE
QIASLERIRATRDDAAVTAALNALTHAAQHNENLLAAAVNAARVRATLGEISDALEVAFD
RYLVPSQCVTGVIAQSYHQSEKSASEFDAIVAQTEQFLADNGRRPRILIAKMGQDGHDRG
AKVIASAYSDLGFDVDLSPMFSTPEEIARLAVENDVHVVGASSLAAGHKTLIPELVEALK
KWGREDICVVAGGVIPPQDYAFLQERGVAAIYGPGTPMLDSVRDVLNLISQHHD
References
External Links:
ResourceLink
Uniprot ID:P27253
Uniprot Name:SBM_ECOLI
GenBank Gene ID:AP009048
Genebank Protein ID:85675350
Ecogene ID:EG11444
Ecocyc:EG11444
ColiBase:b2917
Kegg Gene:b2917
EchoBASE ID:EB1414
CCDB:SBM_ECOLI
BacMap:16130818
General Reference:
  • Blattner, F. R., Plunkett, G. 3rd, Bloch, C. A., Perna, N. T., Burland, V., Riley, M., Collado-Vides, J., Glasner, J. D., Rode, C. K., Mayhew, G. F., Gregor, J., Davis, N. W., Kirkpatrick, H. A., Goeden, M. A., Rose, D. J., Mau, B., Shao, Y. (1997). "The complete genome sequence of Escherichia coli K-12." Science 277:1453-1462. Pubmed: 9278503
  • Hayashi, K., Morooka, N., Yamamoto, Y., Fujita, K., Isono, K., Choi, S., Ohtsubo, E., Baba, T., Wanner, B. L., Mori, H., Horiuchi, T. (2006). "Highly accurate genome sequences of Escherichia coli K-12 strains MG1655 and W3110." Mol Syst Biol 2:2006.0007. Pubmed: 16738553
  • Roy, I., Leadlay, P. F. (1992). "Physical map location of the new Escherichia coli gene sbm." J Bacteriol 174:5763-5764. Pubmed: 1355087