Identification
Name:Probable acrylyl-CoA reductase AcuI
Synonyms:Not Available
Gene Name:acuI
Enzyme Class:
Biological Properties
General Function:zinc ion binding
Specific Function:Probably catalyzes the NADPH-dependent reduction of acrylyl-CoA to propanoyl-CoA.
Cellular Location:Not Available
SMPDB Pathways:Not Available
KEGG Pathways:
  • Microbial metabolism in diverse environments ec01120
  • Reductive carboxylate cycle (CO2 fixation) ec00720
KEGG Reactions:
Thumb+ThumbThumb+Thumb+Thumb
Metabolites:
ECMDB IDNameView
GO Classification:
Function
acryloyl-CoA reductase (NADP+) activity
cytoplasm
zinc ion binding
Gene Properties
Blattner:Not Available
Gene OrientationNot Available
Centisome Percentage:Not Available
Left Sequence EndNot Available
Right Sequence EndNot Available
Gene Sequence:
>975
atgcaggcgttacttttagaacagcaggacggcaaaactctcgcatcagtacagactctg
gacgaaagtcgcctgccggagggcgatgtcacggtcgatgttcactggtcgagcctgaac
tataaagatgcgctggcgattaccggtaagggaaaaatcatccgtaattttccgatgatt
cctgggatcgattttgccggaactgtacgcaccagcgaagatccgcgttttcatgccggt
caggaggtgttactcactggctggggcgttggtgaaaaccactggggtgggctggcggag
caggcgcgagtgaaaggtgactggctggttgccatgccgcaagggctggacgcgcgtaaa
gcaatgattatcggtactgccggttttaccgccatgctgtgtgtgatggcgctggaagat
gccggtgttcgcccgcaggacggggagattgtcgtgacgggtgccagtggtggcgtcggc
agtaccgccgtggcgctgctgcataagttgggttatcaggtcgttgccgtttccggtcgc
gaaagtacccatgaatatctgaaaagtttaggtgctagccgtgttctccctcgtgatgag
tttgccgaatcccgtcctctggaaaaacaagtctgggctggggcaattgacaccgttggc
gacaaagtgctggcaaaagtgctggcgcaaatgaattacggcggctgcgtggcggcctgt
ggtctggcgggtggttttactctgccaaccacggtcatgccatttattctgcgtaatgtc
cgtttgcaaggggtggattcagtaatgacgccaccagaacgccgcgcacaagcctggcag
cgactggtcgccgatttaccggaatcattctatacccaggcggcaaaagagatatctctg
tcagaggcaccgaactttgccgaggccatcattaataaccagatccagggtcgcacgctg
gtgaaggttaactaa
Protein Properties
Pfam Domain Function:Not Available
Protein Residues:324
Protein Molecular Weight:34723
Protein Theoretical pI:Not Available
PDB File:1O89
Signaling Regions:Not Available
Transmembrane Regions:Not Available
Protein Sequence:
>Probable acrylyl-CoA reductase AcuI
MQALLLEQQDGKTLASVQTLDESRLPEGDVTVDVHWSSLNYKDALAITGKGKIIRNFPMI
PGIDFAGTVRTSEDPRFHAGQEVLLTGWGVGENHWGGLAEQARVKGDWLVAMPQGLDARK
AMIIGTAGFTAMLCVMALEDAGVRPQDGEIVVTGASGGVGSTAVALLHKLGYQVVAVSGR
ESTHEYLKSLGASRVLPRDEFAESRPLEKQVWAGAIDTVGDKVLAKVLAQMNYGGCVAAC
GLAGGFTLPTTVMPFILRNVRLQGVDSVMTPPERRAQAWQRLVADLPESFYTQAAKEISL
SEAPNFAEAIINNQIQGRTLVKVN
References
External Links:
ResourceLink
Uniprot ID:P26646
Uniprot Name:ACUI_ECOLI
PDB ID:1O89
CCDB:ACUI_ECOLI
General Reference:Not Available