Identification
Name:Aconitate hydratase 1
Synonyms:
  • Aconitase 1
  • Citrate hydro-lyase 1
Gene Name:acnA
Enzyme Class:
Biological Properties
General Function:Involved in metabolic process
Specific Function:May have an iron-responsive regulatory function
Cellular Location:Not Available
SMPDB Pathways:
KEGG Pathways:
  • Citrate cycle (TCA cycle) ec00020
  • Glyoxylate and dicarboxylate metabolism ec00630
  • Metabolic pathways eco01100
  • Microbial metabolism in diverse environments ec01120
  • Reductive carboxylate cycle (CO2 fixation) ec00720
KEGG Reactions:
Thumb+ThumbThumb
ThumbThumb+Thumb
ThumbThumb
ThumbThumb+Thumb
ThumbThumb+Thumb
Thumb+Thumb+ThumbThumb
SMPDB Reactions:
ThumbThumb+Thumb
Thumb+ThumbThumb
Thumb+ThumbThumb
Thumb+ThumbThumb
EcoCyc Reactions:
Thumb+ThumbThumb
ThumbThumb+Thumb
Complex Reactions:
ThumbThumb
ThumbThumb
Metabolites:
ECMDB IDNameView
ECMDB00072cis-Aconitic acidMetaboCard
ECMDB00094Citric acidMetaboCard
ECMDB24074D-threo-Isocitric acidMetaboCard
ECMDB04088Isocitric acidMetaboCard
ECMDB00494WaterMetaboCard
GO Classification:
Function
4 iron, 4 sulfur cluster binding
binding
iron-sulfur cluster binding
metal cluster binding
Process
metabolic process
Gene Properties
Blattner:b1276
Gene OrientationClockwise
Centisome Percentage:28.75
Left Sequence End1333855
Right Sequence End1336530
Gene Sequence:
>2676 bp
ATGTCGTCAACCCTACGAGAAGCCAGTAAGGACACGTTGCAGGCCAAAGATAAAACTTAC
CACTACTACAGCCTGCCGCTTGCTGCTAAATCACTGGGCGATATCACCCGTCTACCCAAG
TCACTCAAAGTTTTGCTCGAAAACCTGCTGCGCTGGCAGGATGGTAACTCGGTTACCGAA
GAGGATATCCACGCGCTGGCAGGATGGCTGAAAAATGCCCATGCTGACCGTGAAATTGCC
TACCGCCCGGCAAGGGTGCTGATGCAGGACTTTACCGGCGTACCTGCCGTTGTTGATCTG
GCGGCAATGCGCGAAGCGGTTAAACGCCTCGGCGGCGATACTGCAAAGGTTAACCCGCTC
TCACCGGTCGACCTGGTCATTGACCACTCGGTGACCGTCGATCGTTTTGGTGATGATGAG
GCATTTGAAGAAAACGTACGCCTGGAAATGGAGCGCAACCACGAACGTTATGTGTTCCTG
AAATGGGGAAAGCAAGCGTTCAGTCGGTTTAGCGTCGTGCCGCCAGGCACAGGCATTTGC
CATCAGGTTAACCTCGAATATCTCGGCAAAGCAGTGTGGAGTGAATTGCAGGACGGTGAA
TGGATTGCTTATCCGGATACACTCGTTGGTACTGACTCGCACACCACCATGATCAACGGC
CTTGGCGTGCTGGGGTGGGGCGTTGGTGGGATCGAAGCAGAAGCCGCAATGTTAGGCCAG
CCGGTTTCCATGCTTATCCCGGATGTAGTGGGCTTCAAACTTACCGGAAAATTACGTGAA
GGTATTACCGCCACAGACCTGGTTCTCACTGTTACCCAAATGCTGCGCAAACATGGCGTG
GTGGGGAAATTCGTCGAATTTTATGGTGATGGTCTGGATTCACTACCGTTGGCGGATCGC
GCCACCATTGCCAATATGTCGCCAGAATATGGTGCCACCTGTGGCTTCTTCCCAATCGAT
GCTGTAACCCTCGATTACATGCGTTTAAGCGGGCGCAGCGAAGATCAGGTCGAGTTGGTC
GAAAAATATGCCAAAGCGCAGGGCATGTGGCGTAACCCGGGCGATGAACCAATTTTTACC
AGTACGTTAGAACTGGATATGAATGACGTTGAAGCGAGCCTGGCAGGGCCTAAACGCCCA
CAGGATCGCGTTGCACTGCCCGATGTACCAAAAGCATTTGCCGCCAGTAACGAACTGGAA
GTGAATGCCACGCATAAAGATCGCCAGCCGGTCGATTATGTTATGAACGGACATCAGTAT
CAGTTACCTGATGGCGCTGTGGTCATTGCTGCGATAACCTCGTGCACCAACACCTCTAAC
CCAAGTGTGCTGATGGCCGCAGGCTTGCTGGCGAAAAAAGCCGTAACTCTGGGCCTCAAG
CGGCAACCATGGGTCAAAGCGTCGCTGGCACCGGGTTCGAAAGTCGTTTCTGATTATCTG
GCAAAAGCGAAACTGACACCGTATCTCGACGAACTGGGGTTTAACCTTGTGGGATACGGT
TGTACCACCTGTATTGGTAACTCTGGGCCGCTGCCCGATCCTATCGAAACGGCAATCAAA
AAAGGCGATTTAACCGTCGGTGCGGTGCTGTCCGGCAACCGTAACTTTGAAGGCCGTATC
CATCCGCTGGTTAAAACTAACTGGCTGGCCTCGCCGCCGCTGGTGGTTGCCTATGCGCTG
GCGGGAAATATGAATATCAACCTGGCTTCTGAGCCTATCGGCCATGATCGCAAAGGCGAT
CCGGTTTATCTGAAAGATATCTGGCCATCGGCACAAGAAATTGCCCGTGCGGTAGAACAA
GTCTCCACAGAAATGTTCCGCAAAGAGTACGCAGAAGTTTTTGAAGGCACAGCAGAGTGG
AAGGGAATTAACGTCACACGATCCGATACCTACGGTTGGCAGGAGGACTCAACCTATATT
CGCTTATCGCCTTTCTTTGATGAAATGCAGGCAACACCAGCACCAGTGGAAGATATTCAC
GGTGCGCGGATCCTCGCAATGCTGGGGGATTCAGTCACCACTGACCATATCTCTCCGGCG
GGCAGTATTAAGCCCGACAGCCCAGCGGGTCGATATCTACAAGGTCGGGGTGTTGAGCGA
AAAGACTTTAACTCCTACGGTTCGCGGCGTGGTAACCATGAAGTGATGATGCGCGGCACC
TTCGCCAATATTCGCATCCGTAATGAAATGGTGCCTGGCGTTGAAGGGGGGATGACGCGG
CATTTACCTGACAGCGACGTAGTCTCTATTTATGATGCTGCGATGCGCTATAAGCAGGAG
CAAACGCCGCTGGCGGTGATTGCCGGGAAAGAGTATGGATCAGGCTCCAGTCGTGACTGG
GCGGCAAAAGGTCCGCGTCTGCTTGGTATTCGTGTGGTGATTGCCGAATCGTTTGAACGA
ATTCACCGTTCGAATTTAATTGGCATGGGCATCCTGCCGCTGGAATTTCCGCAAGGCGTA
ACGCGTAAAACGTTAGGGCTAACCGGGGAAGAGAAGATTGATATTGGCGATCTGCAAAAC
CTACAACCCGGCGCGACGGTTCCGGTGACGCTTACGCGCGCGGATGGTAGCCAGGAAGTC
GTACCCTGCCGTTGTCGTATCGACACCGCGACGGAGTTGACCTACTACCAGAACGACGGC
ATTTTGCATTATGTCATTCGTAATATGTTGAAGTAA
Protein Properties
Pfam Domain Function:
Protein Residues:891
Protein Molecular Weight:97676
Protein Theoretical pI:6
Signaling Regions:
  • None
Transmembrane Regions:
  • None
Protein Sequence:
>Aconitate hydratase 1
MSSTLREASKDTLQAKDKTYHYYSLPLAAKSLGDITRLPKSLKVLLENLLRWQDGNSVTE
EDIHALAGWLKNAHADREIAYRPARVLMQDFTGVPAVVDLAAMREAVKRLGGDTAKVNPL
SPVDLVIDHSVTVDRFGDDEAFEENVRLEMERNHERYVFLKWGKQAFSRFSVVPPGTGIC
HQVNLEYLGKAVWSELQDGEWIAYPDTLVGTDSHTTMINGLGVLGWGVGGIEAEAAMLGQ
PVSMLIPDVVGFKLTGKLREGITATDLVLTVTQMLRKHGVVGKFVEFYGDGLDSLPLADR
ATIANMSPEYGATCGFFPIDAVTLDYMRLSGRSEDQVELVEKYAKAQGMWRNPGDEPIFT
STLELDMNDVEASLAGPKRPQDRVALPDVPKAFAASNELEVNATHKDRQPVDYVMNGHQY
QLPDGAVVIAAITSCTNTSNPSVLMAAGLLAKKAVTLGLKRQPWVKASLAPGSKVVSDYL
AKAKLTPYLDELGFNLVGYGCTTCIGNSGPLPDPIETAIKKSDLTVGAVLSGNRNFEGRI
HPLVKTNWLASPPLVVAYALAGNMNINLASEPIGHDRKGDPVYLKDIWPSAQEIARAVEQ
VSTEMFRKEYAEVFEGTAEWKGINVTRSDTYGWQEDSTYIRLSPFFDEMQATPAPVEDIH
GARILAMLGDSVTTDHISPAGSIKPDSPAGRYLQGRGVERKDFNSYGSRRGNHEVMMRGT
FANIRIRNEMVPGVEGGMTRHLPDSDVVSIYDAAMRYKQEQTPLAVIAGKEYGSGSSRDW
AAKGPRLLGIRVVIAESFERIHRSNLIGMGILPLEFPQGVTRKTLGLTGEEKIDIGDLQN
LQPGATVPVTLTRADGSQEVVPCRCRIDTATELTYYQNDGILHYVIRNMLK
References
External Links:
ResourceLink
Uniprot ID:P25516
Uniprot Name:ACON1_ECOLI
GenBank Gene ID:AP009048
Genebank Protein ID:1742087
Ecogene ID:EG11325
Ecocyc:EG11325
ColiBase:b1276
Kegg Gene:b1276
EchoBASE ID:EB1301
CCDB:ACON1_ECOLI
BacMap:16129237
General Reference:
  • Aiba, H., Baba, T., Hayashi, K., Inada, T., Isono, K., Itoh, T., Kasai, H., Kashimoto, K., Kimura, S., Kitakawa, M., Kitagawa, M., Makino, K., Miki, T., Mizobuchi, K., Mori, H., Mori, T., Motomura, K., Nakade, S., Nakamura, Y., Nashimoto, H., Nishio, Y., Oshima, T., Saito, N., Sampei, G., Horiuchi, T., et, a. l. .. (1996). "A 570-kb DNA sequence of the Escherichia coli K-12 genome corresponding to the 28.0-40.1 min region on the linkage map." DNA Res 3:363-377. Pubmed: 9097039
  • Blattner, F. R., Plunkett, G. 3rd, Bloch, C. A., Perna, N. T., Burland, V., Riley, M., Collado-Vides, J., Glasner, J. D., Rode, C. K., Mayhew, G. F., Gregor, J., Davis, N. W., Kirkpatrick, H. A., Goeden, M. A., Rose, D. J., Mau, B., Shao, Y. (1997). "The complete genome sequence of Escherichia coli K-12." Science 277:1453-1462. Pubmed: 9278503
  • Hayashi, K., Morooka, N., Yamamoto, Y., Fujita, K., Isono, K., Choi, S., Ohtsubo, E., Baba, T., Wanner, B. L., Mori, H., Horiuchi, T. (2006). "Highly accurate genome sequences of Escherichia coli K-12 strains MG1655 and W3110." Mol Syst Biol 2:2006.0007. Pubmed: 16738553
  • Jordan, P. A., Tang, Y., Bradbury, A. J., Thomson, A. J., Guest, J. R. (1999). "Biochemical and spectroscopic characterization of Escherichia coli aconitases (AcnA and AcnB)." Biochem J 344 Pt 3:739-746. Pubmed: 10585860
  • Prodromou, C., Artymiuk, P. J., Guest, J. R. (1992). "The aconitase of Escherichia coli. Nucleotide sequence of the aconitase gene and amino acid sequence similarity with mitochondrial aconitases, the iron-responsive-element-binding protein and isopropylmalate isomerases." Eur J Biochem 204:599-609. Pubmed: 1541275
  • Prodromou, C., Haynes, M. J., Guest, J. R. (1991). "The aconitase of Escherichia coli: purification of the enzyme and molecular cloning and map location of the gene (acn)." J Gen Microbiol 137:2505-2515. Pubmed: 1838390