Canmetcon
Identification
Name:Protein malY
Synonyms:
  • Cystathionine beta-lyase malY
  • CBL
  • Beta-cystathionase
  • Cysteine lyase
  • Maltose regulon modulator
Gene Name:malY
Enzyme Class:
Biological Properties
General Function:Involved in transferase activity
Specific Function:Acts as a beta-cystathionase and as a repressor of the maltose regulon
Cellular Location:Not Available
SMPDB Pathways:
KEGG Pathways:
KEGG Reactions:
Thumb+ThumbThumb+Thumb+Thumb
Thumb+ThumbThumb+Thumb+Thumb
Thumb+ThumbThumb+Thumb+Thumb
Thumb+ThumbThumb+Thumb+Thumb
Thumb+ThumbThumb+Thumb+Thumb+Thumb
Thumb+Thumb+Thumb+ThumbThumb+Thumb+Thumb
SMPDB Reactions:
ThumbThumb+Thumb+Thumb
ThumbThumb+Homocysteine+Thumb+Thumb
EcoCyc Reactions:
Thumb+ThumbThumb+Thumb+Thumb
Thumb+ThumbThumb+Thumb+Thumb+Thumb
Thumb+ThumbThumb+Thumb+Thumb+Thumb
Complex Reactions:
Thumb+ThumbThumb+Thumb+Thumb
Thumb+ThumbThumb+Thumb+Thumb
Thumb+ThumbThumb+Thumb+Thumb
Metabolites:
ECMDB IDNameView
ECMDB036092-Aminoacrylic acidMetaboCard
ECMDB241982-aminoprop-2-enoateMetaboCard
ECMDB00051AmmoniaMetaboCard
ECMDB21186AmmoniumMetaboCard
ECMDB21649CystathionineMetaboCard
ECMDB24053HomocysteineMetaboCard
ECMDB21225Hydrogen ionMetaboCard
ECMDB03276Hydrogen sulfideMetaboCard
ECMDB00099L-CystathionineMetaboCard
ECMDB00574L-CysteineMetaboCard
ECMDB00192L-CystineMetaboCard
ECMDB00165L-HomocysteineMetaboCard
ECMDB00243Pyruvic acidMetaboCard
ECMDB06343SelenocystathionineMetaboCard
ECMDB21010SelenohomocysteineMetaboCard
ECMDB00494WaterMetaboCard
GO Classification:
Function
binding
catalytic activity
cofactor binding
pyridoxal phosphate binding
transferase activity
transferase activity, transferring nitrogenous groups
Process
biosynthetic process
metabolic process
Gene Properties
Blattner:b1622
Gene OrientationClockwise
Centisome Percentage:36.62
Left Sequence End1698981
Right Sequence End1700153
Gene Sequence:
>1173 bp
ATGCGGAAACTCTGGAACGCGCTACGCCGACCCAGTGCTCGTTGGTCGGTACTGGCGCTG
GTCGCAATTGGGATTGTGATTGGCATTGCGCTGATTGTATTGCCACACGTTGGGATCAAA
GTCACCAGCACAACCGAATTTTGTGTCAGTTGCCACAGTATGCAACCGGTGTATGAAGAA
TATAAACAGTCGGTGCATTTCCAGAACGCCTCCGGCGTGCGAGCTGAATGCCATGACTGT
CATATCCCGCCGGATATTCCAGGCATGGTGAAGCGCAAACTGGAAGCGAGCAATGATATC
TACCAGACCTTTATTGCTCACTCCATTGATACACCTGAAAAATTCGAAGCCAAACGCGCG
GAACTTGCCGAGCGTGAATGGGCGCGAATGAAAGAAAACAACTCGGCAACCTGCCGCTCC
TGCCATAACTACGATGCGATGGATCATGCGAAGCAGCATCCTGAAGCAGCACGTCAGATG
AAGGTGGCAGCGAAAGATAATCAATCCTGCATCGACTGTCATAAAGGTATTGCCCACCAG
TTACCGGATATGAGTAGCGGCTTCCGTAAGCAGTTCGATGAGCTGCGCGCCAGTGCTAAT
GACAGTGGTGACACGCTGTACTCTATTGATATTAAGCCAATTTATGCGGCGAAAGGCGAT
AAAGAAGCCTCTGGTTCTCTGCTGCCTGCTTCGGAAGTGAAAGTCCTTAAACGTGACGGC
GACTGGCTGCAAATTGAAATTACCGGCTGGACGGAAAGCGCCGGACGTCAGCGTGTACTC
ACCCAATTCCCAGGTAAACGCATCTTTGTTGCCTCGATTCGTGGTGATGTGCAGCAGCAG
GTAAAAACGCTGGAGAAAACCACCGTTGCCGACACCAATACCGAGTGGAGCAAGTTGCAG
GCCACTGCGTGGATGAAGAAAGGCGACATGGTGAACGATATCAAACCGATCTGGGCTTAT
GCGGATTCGTTGTACAACGGCACCTGTAACCAGTGCCACGGCGCACCGGAAATCGCCCAC
TTTGACGCTAACGGTTGGATCGGCACGCTCAACGGCATGATTGGCTTTACCAGTCTCGAT
AAACGTGAAGAACGCACCTTGTTGAAATATCTGCAAATGAATGCGTCTGACACCGCAGGT
AAGGCTCACGGCGATAAGAAGGAAGAAAAATAA
Protein Properties
Pfam Domain Function:
Protein Residues:390
Protein Molecular Weight:43641
Protein Theoretical pI:5
PDB File:1D2F
Signaling Regions:
  • None
Transmembrane Regions:
  • None
Protein Sequence:
>Protein malY
MFDFSKVVDRHGTWCTQWDYVADRFGTADLLPFTISDMDFATAPCIIEALNQRLMHGVFG
YSRWKNDEFLAAIAHWFSTQHYTAIDSQTVVYGPSVIYMVSELIRQWSETGEGVVIHTPA
YDAFYKAIEGNQRTVMPVALEKQADGWFCDMGKLEAVLAKPECKIMLLCSPQNPTGKVWT
CDELEIMADLCERHGVRVISDEIHMDMVWGEQPHIPWSNVARGDWALLTSGSKSFNIPAL
TGAYGIIENSSSRDAYLSALKGRDGLSSPSVLALTAHIAAYQQGAPWLDALRIYLKDNLT
YIADKMNAAFPELNWQIPQSTYLAWLDLRPLNIDDNALQKALIEQEKVAIMPGYTYGEEG
RGFVRLNAGCPRSKLEKGVAGLINAIRAVR
References
External Links:
ResourceLink
Uniprot ID:P23256
Uniprot Name:MALY_ECOLI
GenBank Gene ID:AP009048
Genebank Protein ID:1651488
PDB ID:1D2F
Ecogene ID:EG10564
Ecocyc:EG10564
ColiBase:b1622
Kegg Gene:b1622
EchoBASE ID:EB0559
CCDB:MALY_ECOLI
BacMap:16129580
General Reference:
  • Aiba, H., Baba, T., Hayashi, K., Inada, T., Isono, K., Itoh, T., Kasai, H., Kashimoto, K., Kimura, S., Kitakawa, M., Kitagawa, M., Makino, K., Miki, T., Mizobuchi, K., Mori, H., Mori, T., Motomura, K., Nakade, S., Nakamura, Y., Nashimoto, H., Nishio, Y., Oshima, T., Saito, N., Sampei, G., Horiuchi, T., et, a. l. .. (1996). "A 570-kb DNA sequence of the Escherichia coli K-12 genome corresponding to the 28.0-40.1 min region on the linkage map." DNA Res 3:363-377. Pubmed: 9097039
  • Blattner, F. R., Plunkett, G. 3rd, Bloch, C. A., Perna, N. T., Burland, V., Riley, M., Collado-Vides, J., Glasner, J. D., Rode, C. K., Mayhew, G. F., Gregor, J., Davis, N. W., Kirkpatrick, H. A., Goeden, M. A., Rose, D. J., Mau, B., Shao, Y. (1997). "The complete genome sequence of Escherichia coli K-12." Science 277:1453-1462. Pubmed: 9278503
  • Clausen, T., Schlegel, A., Peist, R., Schneider, E., Steegborn, C., Chang, Y. S., Haase, A., Bourenkov, G. P., Bartunik, H. D., Boos, W. (2000). "X-ray structure of MalY from Escherichia coli: a pyridoxal 5'-phosphate-dependent enzyme acting as a modulator in mal gene expression." EMBO J 19:831-842. Pubmed: 10698925
  • Hayashi, K., Morooka, N., Yamamoto, Y., Fujita, K., Isono, K., Choi, S., Ohtsubo, E., Baba, T., Wanner, B. L., Mori, H., Horiuchi, T. (2006). "Highly accurate genome sequences of Escherichia coli K-12 strains MG1655 and W3110." Mol Syst Biol 2:2006.0007. Pubmed: 16738553
  • Reidl, J., Boos, W. (1991). "The malX malY operon of Escherichia coli encodes a novel enzyme II of the phosphotransferase system recognizing glucose and maltose and an enzyme abolishing the endogenous induction of the maltose system." J Bacteriol 173:4862-4876. Pubmed: 1856179
  • Zdych, E., Peist, R., Reidl, J., Boos, W. (1995). "MalY of Escherichia coli is an enzyme with the activity of a beta C-S lyase (cystathionase)." J Bacteriol 177:5035-5039. Pubmed: 7665481