Identification
Name:Non-specific ribonucleoside hydrolase rihC
Synonyms:
  • Purine/pyrimidine ribonucleoside hydrolase
Gene Name:rihC
Enzyme Class:Not Available
Biological Properties
General Function:Involved in hydrolase activity, hydrolyzing N-glycosyl compounds
Specific Function:Hydrolyzes both purine and pyrimidine ribonucleosides with a broad-substrate specificity with decreasing activity in the order uridine, xanthosine, inosine, adenosine, cytidine, guanosine
Cellular Location:Cytoplasmic
SMPDB Pathways:Not Available
KEGG Pathways:Not Available
KEGG Reactions:
Thumb+ThumbThumb+Thumb
Thumb+ThumbThumb+Thumb
Thumb+ThumbThumb+Thumb
EcoCyc Reactions:
Thumb+ThumbD-ribose+Thumb
Thumb+ThumbD-ribose+Thumb
Thumb+ThumbD-ribose+Thumb
Thumb+ThumbD-ribose+Thumb
Thumb+ThumbD-ribose+Thumb
Complex Reactions:
Thumb+ThumbThumb+Thumb
Thumb+ThumbThumb+Thumb
Metabolites:
ECMDB IDNameView
ECMDB00034AdenineMetaboCard
ECMDB00050AdenosineMetaboCard
ECMDB00089CytidineMetaboCard
ECMDB00630CytosineMetaboCard
ECMDB00157HypoxanthineMetaboCard
ECMDB00195InosineMetaboCard
ECMDB00283RiboseMetaboCard
ECMDB00300UracilMetaboCard
ECMDB00296UridineMetaboCard
ECMDB00494WaterMetaboCard
ECMDB00292XanthineMetaboCard
ECMDB00299XanthosineMetaboCard
GO Classification:
Function
catalytic activity
hydrolase activity
hydrolase activity, acting on glycosyl bonds
hydrolase activity, hydrolyzing N-glycosyl compounds
Gene Properties
Blattner:b0030
Gene OrientationClockwise
Centisome Percentage:0.59
Left Sequence End27293
Right Sequence End28207
Gene Sequence:
>915 bp
ATGCGTTTACCTATCTTCCTCGATACTGACCCCGGCATTGACGATGCCGTCGCCATTGCC
GCCGCGATTTTTGCACCCGAACTCGACCTGCAACTGATGACCACCGTCGCGGGTAATGTC
TCGGTTGAGAAAACTACCCGCAATGCCCTGCAACTGCTGCATTTCTGGAATGCGGAGATT
CCGCTCGCCCAAGGGGCCGCTGTGCCACTGGTACGCGCACCGCGTGATGCGGCATCTGTG
CACGGCGAATCGGGAATGGCTGGCTACGACTTTGTTGAGCACAACCGAAAGCCGCTCGGG
ATACCGGCGTTTCTGGCGATTCGGGATGCCCTGATGCGTGCACCAGAGCCTGTTACCCTG
GTGGCCATCGGCCCGTTAACCAATATTGCGCTGTTACTTTCACAATGCCCGGAATGCAAG
CCGTATATTCGCCGTCTGGTGATCATGGGTGGTTCTGCCGGACGCGGCAACTGTACGCCA
AACGCCGAGTTTAATATTGCTGCCGATCCAGAAGCTGCTGCCTGTGTCTTCCGCAGTGGT
ATTGAAATCGTCATGTGCGGTTTGGATGTCACCAATCAGGCAATATTAACTCCTGACTAT
CTCTCTACACTGCCGCAGTTAAACCGTACCGGGAAAATGCTTCACGCCCTGTTTAGCCAC
TACCGTAGCGGCAGTATGCAAAGCGGCTTGCGAATGCACGATCTCTGCGCCATCGCCTGG
CTGGTGCGCCCGGACCTGTTCACTCTCAAACCCTGTTTTGTGGCAGTGGAAACTCAGGGC
GAATTTACCTCAGGCACGACGGTGGTTGATATCGACGGTTGCCTGGGCAAGCCAGCCAAT
GTACAGGTGGCATTGGATCTGGATGTGAAAGGCTTCCAGCAGTGGGTGGCTGAGGTGCTG
GCTCTGGCGTCGTAA
Protein Properties
Pfam Domain Function:
Protein Residues:304
Protein Molecular Weight:32560
Protein Theoretical pI:5
Signaling Regions:
  • None
Transmembrane Regions:
  • None
Protein Sequence:
>Non-specific ribonucleoside hydrolase rihC
MRLPIFLDTDPGIDDAVAIAAAIFAPELDLQLMTTVAGNVSVEKTTRNALQLLHFWNAEI
PLAQGAAVPLVRAPRDAASVHGESGMAGYDFVEHNRKPLGIPAFLAIRDALMRAPEPVTL
VAIGPLTNIALLLSQCPECKPYIRRLVIMGGSAGRGNCTPNAEFNIAADPEAAACVFRSG
IEIVMCGLDVTNQAILTPDYLSTLPQLNRTGKMLHALFSHYRSGSMQSGLRMHDLCAIAW
LVRPDLFTLKPCFVAVETQGEFTSGTTVVDIDGCLGKPANVQVALDLDVKGFQQWVAEVL
ALAS
References
External Links:
ResourceLink
Uniprot ID:P22564
Uniprot Name:RIHC_ECOLI
GenBank Gene ID:AP009048
Genebank Protein ID:21321912
Ecogene ID:EG11082
Ecocyc:EG11082
ColiBase:b0030
Kegg Gene:b0030
EchoBASE ID:EB1074
CCDB:RIHC_ECOLI
BacMap:16128024
General Reference:
  • Blattner, F. R., Plunkett, G. 3rd, Bloch, C. A., Perna, N. T., Burland, V., Riley, M., Collado-Vides, J., Glasner, J. D., Rode, C. K., Mayhew, G. F., Gregor, J., Davis, N. W., Kirkpatrick, H. A., Goeden, M. A., Rose, D. J., Mau, B., Shao, Y. (1997). "The complete genome sequence of Escherichia coli K-12." Science 277:1453-1462. Pubmed: 9278503
  • Bouvier, J., Stragier, P. (1991). "Nucleotide sequence of the lsp-dapB interval in Escherichia coli." Nucleic Acids Res 19:180. Pubmed: 2011499
  • Hayashi, K., Morooka, N., Yamamoto, Y., Fujita, K., Isono, K., Choi, S., Ohtsubo, E., Baba, T., Wanner, B. L., Mori, H., Horiuchi, T. (2006). "Highly accurate genome sequences of Escherichia coli K-12 strains MG1655 and W3110." Mol Syst Biol 2:2006.0007. Pubmed: 16738553
  • Petersen, C., Moller, L. B. (2001). "The RihA, RihB, and RihC ribonucleoside hydrolases of Escherichia coli. Substrate specificity, gene expression, and regulation." J Biol Chem 276:884-894. Pubmed: 11027694
  • Yura, T., Mori, H., Nagai, H., Nagata, T., Ishihama, A., Fujita, N., Isono, K., Mizobuchi, K., Nakata, A. (1992). "Systematic sequencing of the Escherichia coli genome: analysis of the 0-2.4 min region." Nucleic Acids Res 20:3305-3308. Pubmed: 1630901