Identification
Name:Adenosine deaminase
Synonyms:
  • Adenosine aminohydrolase
Gene Name:add
Enzyme Class:
Biological Properties
General Function:Involved in deaminase activity
Specific Function:Adenosine + H(2)O = inosine + NH(3)
Cellular Location:Cytoplasmic
SMPDB Pathways:
KEGG Pathways:
KEGG Reactions:
Thumb+ThumbThumb+Thumb
Thumb+ThumbThumb+Thumb
Thumb+ThumbThumb+Thumb
Thumb+ThumbThumb+Thumb
SMPDB Reactions:
Thumb+Thumb+ThumbThumb+Thumb
Thumb+ThumbThumb+Thumb+Thumb
EcoCyc Reactions:
Thumb+ThumbThumb+Thumb
Thumb+ThumbThumb+Thumb
Complex Reactions:
Thumb+Thumb+ThumbThumb+Thumb
Thumb+Thumb+ThumbThumb+Thumb
Thumb+ThumbThumb+Thumb
Thumb+ThumbThumb+Thumb
Metabolites:
ECMDB IDNameView
ECMDB00050AdenosineMetaboCard
ECMDB00051AmmoniaMetaboCard
ECMDB21186AmmoniumMetaboCard
ECMDB00101DeoxyadenosineMetaboCard
ECMDB00071DeoxyinosineMetaboCard
ECMDB21225Hydrogen ionMetaboCard
ECMDB00195InosineMetaboCard
ECMDB00494WaterMetaboCard
GO Classification:
Function
adenosine deaminase activity
catalytic activity
deaminase activity
hydrolase activity
hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds
hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds, in cyclic amidines
Process
cellular nitrogen compound metabolic process
metabolic process
nitrogen compound metabolic process
nucleobase, nucleoside and nucleotide metabolic process
nucleobase, nucleoside, nucleotide and nucleic acid metabolic process
nucleoside phosphate metabolic process
nucleotide metabolic process
purine nucleoside monophosphate biosynthetic process
purine nucleotide biosynthetic process
purine nucleotide metabolic process
purine ribonucleoside monophosphate biosynthetic process
Gene Properties
Blattner:b1623
Gene OrientationClockwise
Centisome Percentage:36.65
Left Sequence End1700257
Right Sequence End1701258
Gene Sequence:
>1002 bp
ATGATTGATACCACCCTGCCATTAACTGATATCCATCGCCACCTTGATGGCAACATTCGT
CCCCAGACCATTCTTGAACTTGGCCGCCAGTATAATATCTCGCTTCCTGCACAATCCCTG
GAAACACTGATTCCCCACGTTCAGGTCATTGCCAACGAACCCGATCTGGTGAGCTTTCTG
ACCAAACTTGACTGGGGCGTTAAAGTTCTCGCCTCTCTTGATGCCTGTCGCCGCGTGGCA
TTTGAAAACATTGAAGATGCAGCCCGTCACGGCCTGCACTATGTCGAGCTGCGTTTTTCA
CCAGGCTACATGGCAATGGCACATCAGCTGCCTGTAGCGGGTGTTGTCGAAGCGGTGATC
GATGGCGTACGTGAAGGTTGCCGCACCTTTGGTGTGCAGGCGAAGCTTATCGGCATTATG
AGCCGGACCTTCGGCGAAGCCGCCTGTCAGCAAGAGCTGGAGGCCTTTTTAGCCCACCGT
GACCAGATTACCGCACTTGATTTAGCCGGTGATGAACTTGGTTTCCCGGGAAGTCTGTTC
CTTTCTCACTTCAACCGCGCGCGTGATGCGGGCTGGCATATTACCGTCCATGCAGGCGAA
GCTGCCGGGCCGGAAAGCATCTGGCAGGCGATTCGTGAACTGGGTGCGGAGCGTATTGGA
CATGGCGTAAAAGCCATTGAAGATCGGGCGCTGATGGATTTTCTCGCCGAGCAACAAATT
GGTATTGAATCCTGTCTGACCTCCAATATTCAGACCAGCACCGTAGCAGAGCTGGCTGCA
CATCCGCTGAAAACGTTCCTTGAGCATGGCATTCGTGCCAGCATTAACACTGACGATCCC
GGCGTACAGGGAGTGGATATCATTCACGAATATACCGTTGCCGCGCCAGCTGCTGGGTTA
TCCCGCGAGCAAATCCGCCAGGCACAGATTAATGGTCTGGAAATGGCTTTCCTCAGCGCT
GAGGAAAAACGCGCACTGCGAGAAAAAGTCGCCGCGAAGTAA
Protein Properties
Pfam Domain Function:
Protein Residues:333
Protein Molecular Weight:36397
Protein Theoretical pI:5
Signaling Regions:
  • None
Transmembrane Regions:
  • None
Protein Sequence:
>Adenosine deaminase
MIDTTLPLTDIHRHLDGNIRPQTILELGRQYNISLPAQSLETLIPHVQVIANEPDLVSFL
TKLDWGVKVLASLDACRRVAFENIEDAARHGLHYVELRFSPGYMAMAHQLPVAGVVEAVI
DGVREGCRTFGVQAKLIGIMSRTFGEAACQQELEAFLAHRDQITALDLAGDELGFPGSLF
LSHFNRARDAGWHITVHAGEAAGPESIWQAIRELGAERIGHGVKAIEDRALMDFLAEQQI
GIESCLTSNIQTSTVAELAAHPLKTFLEHGIRASINTDDPGVQGVDIIHEYTVAAPAAGL
SREQIRQAQINGLEMAFLSAEEKRALREKVAAK
References
External Links:
ResourceLink
Uniprot ID:P22333
Uniprot Name:ADD_ECOLI
GenBank Gene ID:AP009048
Genebank Protein ID:1742677
Ecogene ID:EG10030
Ecocyc:EG10030
ColiBase:b1623
Kegg Gene:b1623
EchoBASE ID:EB0029
CCDB:ADD_ECOLI
BacMap:16129581
General Reference:
  • Aiba, H., Baba, T., Hayashi, K., Inada, T., Isono, K., Itoh, T., Kasai, H., Kashimoto, K., Kimura, S., Kitakawa, M., Kitagawa, M., Makino, K., Miki, T., Mizobuchi, K., Mori, H., Mori, T., Motomura, K., Nakade, S., Nakamura, Y., Nashimoto, H., Nishio, Y., Oshima, T., Saito, N., Sampei, G., Horiuchi, T., et, a. l. .. (1996). "A 570-kb DNA sequence of the Escherichia coli K-12 genome corresponding to the 28.0-40.1 min region on the linkage map." DNA Res 3:363-377. Pubmed: 9097039
  • Blattner, F. R., Plunkett, G. 3rd, Bloch, C. A., Perna, N. T., Burland, V., Riley, M., Collado-Vides, J., Glasner, J. D., Rode, C. K., Mayhew, G. F., Gregor, J., Davis, N. W., Kirkpatrick, H. A., Goeden, M. A., Rose, D. J., Mau, B., Shao, Y. (1997). "The complete genome sequence of Escherichia coli K-12." Science 277:1453-1462. Pubmed: 9278503
  • Chang, Z. Y., Nygaard, P., Chinault, A. C., Kellems, R. E. (1991). "Deduced amino acid sequence of Escherichia coli adenosine deaminase reveals evolutionarily conserved amino acid residues: implications for catalytic function." Biochemistry 30:2273-2280. Pubmed: 1998686
  • Hayashi, K., Morooka, N., Yamamoto, Y., Fujita, K., Isono, K., Choi, S., Ohtsubo, E., Baba, T., Wanner, B. L., Mori, H., Horiuchi, T. (2006). "Highly accurate genome sequences of Escherichia coli K-12 strains MG1655 and W3110." Mol Syst Biol 2:2006.0007. Pubmed: 16738553