Identification
Name:ATP-dependent RNA helicase srmB
Synonyms:Not Available
Gene Name:srmB
Enzyme Class:
Biological Properties
General Function:Replication, recombination and repair
Specific Function:RNA-dependent ATPase activity. Acts in 50S ribosomal subunit biogenesis at low temperatures, acting before deaD/csdA. Suppressor of a mutant defective in 50S ribosomal subunit assembly. Probably interacts with 23S ribosomal RNA
Cellular Location:Cytoplasmic
SMPDB Pathways:Not Available
KEGG Pathways:Not Available
Complex Reactions:
Thumb+ThumbThumb+Thumb
Thumb+ThumbThumb+Thumb
Thumb+ThumbThumb+Thumb
Thumb+ThumbThumb+Thumb
Thumb+ThumbThumb+Thumb
Thumb+ThumbThumb+Thumb
Thumb+ThumbThumb+Thumb
Thumb+ThumbThumb+Thumb
Thumb+ThumbThumb+Thumb
Thumb+ThumbThumb+Thumb
Thumb+ThumbThumb+Thumb
Thumb+ThumbThumb+Thumb
Thumb+ThumbThumb+Thumb
Thumb+ThumbThumb+Thumb
Thumb+ThumbThumb+Thumb
Thumb+ThumbThumb+Thumb
Thumb+ThumbThumb+Thumb
Thumb+ThumbThumb+Thumb
Metabolites:
ECMDB IDNameView
ECMDB00538Adenosine triphosphateMetaboCard
ECMDB01341ADPMetaboCard
ECMDB21380Inorganic phosphateMetaboCard
ECMDB00494WaterMetaboCard
GO Classification:
Function
adenyl nucleotide binding
adenyl ribonucleotide binding
ATP binding
ATP-dependent helicase activity
ATPase activity
ATPase activity, coupled
binding
catalytic activity
helicase activity
hydrolase activity
hydrolase activity, acting on acid anhydrides
hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides
nucleic acid binding
nucleoside binding
nucleoside-triphosphatase activity
purine nucleoside binding
pyrophosphatase activity
Gene Properties
Blattner:Not Available
Gene OrientationNot Available
Centisome Percentage:Not Available
Left Sequence EndNot Available
Right Sequence EndNot Available
Gene Sequence:
>1335 bp
ATGACTGTAACGACTTTTTCCGAACTTGAACTCGACGAAAGCCTGCTGGAAGCCCTCCAG
GATAAAGGTTTCACTCGCCCGACCGCCATTCAGGCTGCCGCCATTCCGCCTGCGCTCGAT
GGCCGTGATGTACTCGGTTCTGCGCCGACAGGCACCGGTAAAACGGCGGCGTATCTGCTG
CCAGCGTTGCAGCACCTGCTCGATTTCCCGCGTAAGAAATCCGGTCCGCCGCGTATTTTG
ATCCTCACCCCAACTCGCGAGCTGGCGATGCAGGTGTCCGATCATGCCCGCGAACTGGCG
AAACATACGCATCTGGATATCGCCACCATCACCGGCGGCGTAGCCTATATGAACCACGCG
GAAGTGTTCAGCGAAAATCAGGACATCGTGGTCGCCACGACCGGACGTCTGCTGCAATAC
ATAAAAGAAGAGAACTTCGATTGCCGCGCGGTTGAAACGCTGATCCTCGACGAAGCAGAC
CGTATGCTGGATATGGGCTTCGCTCAGGATATCGAACATATTGCTGGCGAAACGCGCTGG
CGTAAACAGACCCTGCTCTTTTCGGCAACGCTGGAAGGCGATGCGATTCAGGACTTTGCC
GAGCGTCTGCTGGAAGATCCGGTGGAAGTTTCTGCCAATCCCTCCACCCGTGAGCGCAAA
AAAATTCATCAGTGGTATTACCGCGCCGATGATCTTGAGCATAAAACCGCGTTGCTGGTG
CATCTGTTAAAACAGCCGGAAGCGACCCGCTCAATTGTGTTTGTGCGTAAGCGTGAGCGT
GTGCATGAGCTGGCAAACTGGCTGCGCGAAGCGGGCATCAACAACTGCTATCTCGAAGGT
GAGATGGTACAGGGCAAGCGTAACGAAGCGATCAAGCGTTTGACCGAAGGTCGCGTAAAC
GTACTGGTCGCAACCGATGTTGCCGCGCGCGGTATCGACATTCCTGACGTCAGCCACGTC
TTTAACTTCGATATGCCGCGCAGTGGCGATACTTATTTGCACCGTATCGGACGTACCGCG
CGCGCCGGTCGTAAAGGCACCGCAATTTCGCTGGTGGAAGCCCATGACCATCTGCTGCTG
GGTAAAGTAGGCCGCTATATTGAAGAGCCAATTAAAGCTCGCGTTATTGATGAGTTACGC
CCGAAAACGCGTGCGCCAAGCGAAAAGCAGACCGGCAAGCCATCGAAGAAAGTACTGGCT
AAACGTGCTGAGAAGAAAAAAGCTAAAGAGAAAGAGAAGCCGCGGGTGAAAAAACGCCAT
CGCGACACCAAAAATATTGGTAAGCGCCGTAAACCAAGCGGAACGGGCGTGCCACCGCAA
ACGACAGAAGAGTAA
Protein Properties
Pfam Domain Function:
Protein Residues:444
Protein Molecular Weight:49914
Protein Theoretical pI:10
Signaling Regions:
  • None
Transmembrane Regions:
  • None
Protein Sequence:
>ATP-dependent RNA helicase srmB
MTVTTFSELELDESLLEALQDKGFTRPTAIQAAAIPPALDGRDVLGSAPTGTGKTAAYLL
PALQHLLDFPRKKSGPPRILILTPTRELAMQVSDHARELAKHTHLDIATITGGVAYMNHA
EVFSENQDIVVATTGRLLQYIKEENFDCRAVETLILDEADRMLDMGFAQDIEHIAGETRW
RKQTLLFSATLEGDAIQDFAERLLEDPVEVSANPSTRERKKIHQWYYRADDLEHKTALLV
HLLKQPEATRSIVFVRKRERVHELANWLREAGINNCYLEGEMVQGKRNEAIKRLTEGRVN
VLVATDVAARGIDIPDVSHVFNFDMPRSGDTYLHRIGRTARAGRKGTAISLVEAHDHLLL
GKVGRYIEEPIKARVIDELRPKTRAPSEKQTGKPSKKVLAKRAEKKKAKEKEKPRVKKRH
RDTKNIGKRRKPSGTGVPPQTTEE
References
External Links:
ResourceLink
Uniprot ID:P21507
Uniprot Name:SRMB_ECOLI
GenBank Gene ID:D13169
Genebank Protein ID:285777
CCDB:SRMB_ECOLI
General Reference:
  • Bizebard, T., Ferlenghi, I., Iost, I., Dreyfus, M. (2004). "Studies on three E. coli DEAD-box helicases point to an unwinding mechanism different from that of model DNA helicases." Biochemistry 43:7857-7866. Pubmed: 15196029
  • Blattner, F. R., Plunkett, G. 3rd, Bloch, C. A., Perna, N. T., Burland, V., Riley, M., Collado-Vides, J., Glasner, J. D., Rode, C. K., Mayhew, G. F., Gregor, J., Davis, N. W., Kirkpatrick, H. A., Goeden, M. A., Rose, D. J., Mau, B., Shao, Y. (1997). "The complete genome sequence of Escherichia coli K-12." Science 277:1453-1462. Pubmed: 9278503
  • Charollais, J., Dreyfus, M., Iost, I. (2004). "CsdA, a cold-shock RNA helicase from Escherichia coli, is involved in the biogenesis of 50S ribosomal subunit." Nucleic Acids Res 32:2751-2759. Pubmed: 15148362
  • Hayashi, K., Morooka, N., Yamamoto, Y., Fujita, K., Isono, K., Choi, S., Ohtsubo, E., Baba, T., Wanner, B. L., Mori, H., Horiuchi, T. (2006). "Highly accurate genome sequences of Escherichia coli K-12 strains MG1655 and W3110." Mol Syst Biol 2:2006.0007. Pubmed: 16738553
  • Nishi, K., Morel-Deville, F., Hershey, J. W., Leighton, T., Schnier, J. (1988). "An eIF-4A-like protein is a suppressor of an Escherichia coli mutant defective in 50S ribosomal subunit assembly." Nature 336:496-498. Pubmed: 2461520