Identification
Name:Phosphatidylglycerophosphatase A
Synonyms:Not Available
Gene Name:pgpA
Enzyme Class:
Biological Properties
General Function:Involved in phosphatidylglycerophosphatase activity
Specific Function:One of the three phospholipid phosphatases, specifically hydrolyzes phosphatidylglycerophosphate
Cellular Location:Cell inner membrane; Multi-pass membrane protein
SMPDB Pathways:
  • phospholipid biosynthesis CL(15:0cyclo/15:0cyclo/15:0cyclo/18:1(9Z)) PW001064
  • phospholipid biosynthesis CL(15:0cyclo/15:0cyclo/15:0cyclo/19:0cycv8c) PW001065
  • phospholipid biosynthesis CL(15:0cyclo/15:0cyclo/18:1(9Z)/15:0cyclo) PW001082
  • phospholipid biosynthesis (CL(10:0(3-OH)/10:0/10:0(3-OH)/10:0)) PW001899
  • phospholipid biosynthesis (CL(10:0(3-OH)/12:0(3-OH)/10:0(3-OH)/12:0(3-OH))) PW001900
  • phospholipid biosynthesis (CL(10:0(3-OH)/12:0/10:0(3-OH)/12:0)) PW001901
  • phospholipid biosynthesis (CL(10:0(3-OH)/15:0cyclo/10:0(3-OH)/15:0cyclo)) PW001902
  • phospholipid biosynthesis (CL(10:0(3-OH)/16:0/10:0(3-OH)/16:0)) PW001904
  • phospholipid biosynthesis (CL(10:0(3-OH)/16:1(9Z)/10:0(3-OH)/16:1(9Z))) PW001903
  • phospholipid biosynthesis (CL(10:0(3-OH)/17:0cycw7c/10:0(3-OH)/17:0cycw7c)) PW001906
  • phospholipid biosynthesis (CL(10:0(3-OH)/17:0cycw7c/14:0/14:0)) PW001907
  • phospholipid biosynthesis (CL(10:0(3-OH)/19:0cycv8c/10:0(3-OH)/19:0cycv8c)) PW001908
  • phospholipid biosynthesis (CL(10:0(3-OH)/19:iso/10:0(3-OH)/19:iso)) PW001909
  • phospholipid biosynthesis (CL(10:0/10:0(3-OH)/10:0/10:0(3-OH))) PW001910
  • phospholipid biosynthesis (CL(10:0/12:0(3-OH)/10:0/12:0(3-OH))) PW001911
  • phospholipid biosynthesis (CL(10:0/17:0cycw7c/14:0/14:0)) PW001912
  • phospholipid biosynthesis (CL(12:0(3-OH)/10:0(3-OH)/12:0(3-OH)/10:0(3-OH))) PW001913
  • phospholipid biosynthesis (CL(12:0(3-OH)/10:0/12:0(3-OH)/10:0)) PW001914
  • phospholipid biosynthesis (CL(12:0(3-OH)/12:0(3-OH)/12:0/12:0)) PW001915
  • phospholipid biosynthesis (CL(12:0(3-OH)/14:0(3-OH)/12:0(3-OH)/14:0(3-OH))) PW001918
  • phospholipid biosynthesis (CL(12:0(3-OH)/14:0/12:0(3-OH)/14:0)) PW001919
  • phospholipid biosynthesis (CL(12:0(3-OH)/15:0/12:0(3-OH)/15:0)) PW001920
  • phospholipid biosynthesis (CL(12:0(3-OH)/15:0cyclo/12:0(3-OH)/15:0cyclo)) PW001921
  • phospholipid biosynthesis (CL(12:0(3-OH)/17:0cycw7c/12:0(3-OH)/17:0cycw7c)) PW001922
  • phospholipid biosynthesis (CL(12:0(3-OH)/18:1(9Z)/12:0(3-OH)/18:1(9Z))) PW001924
  • phospholipid biosynthesis (CL(12:0(3-OH)/19:0cycv8c/12:0(3-OH)/19:0cycv8c)) PW001925
  • phospholipid biosynthesis (CL(12:0(3-OH)/19:iso/12:0(3-OH)/19:iso)) PW001926
  • phospholipid biosynthesis (CL(12:0/10:0(3-OH)/12:0/10:0(3-OH))) PW001928
  • phospholipid biosynthesis (CL(12:0/12:0/12:0/12:0)) PW001930
  • phospholipid biosynthesis (CL(12:0/14:0(3-OH)/12:0/14:0(3-OH))) PW001931
  • phospholipid biosynthesis (CL(12:0/19:iso/12:0/19:iso)) PW001933
  • phospholipid biosynthesis (CL(14:0(3-OH)/12:0(3-OH)/14:0(3-OH)/12:0(3-OH))) PW001934
  • phospholipid biosynthesis (CL(14:0(3-OH)/12:0/14:0(3-OH)/12:0)) PW001935
  • phospholipid biosynthesis (CL(14:0(3-OH)/16:1(9Z)/14:0(3-OH)/16:1(9Z))) PW001939
  • phospholipid biosynthesis (CL(14:0(3-OH)/17:0cycw7c/14:0(3-OH)/17:0cycw7c)) PW001941
  • phospholipid biosynthesis (CL(14:0/12:0(3-OH)/14:0/12:0(3-OH))) PW001943
  • phospholipid biosynthesis (CL(14:0/15:0cyclo/17:0cycw7c/14:0) PW001030
  • phospholipid biosynthesis (CL(15:0/10:0(3-OH)/15:0/10:0(3-OH))) PW001945
  • phospholipid biosynthesis (CL(15:0/12:0(3-OH)/15:0/12:0(3-OH))) PW001946
  • phospholipid biosynthesis (CL(15:0cyclo/10:0(3-OH)/15:0cyclo/10:0(3-OH))) PW001948
  • phospholipid biosynthesis (CL(15:0cyclo/15:0cyclo/18:1(9Z)/16:0)) 1442599180 PW002016
  • phospholipid biosynthesis (CL(15:0cyclo/15:0cyclo/19:0cycv8c/19:0cycv8c)) PW001789
  • phospholipid biosynthesis (CL(15:0cyclo/16:0/19:0cycv8c/15:0cyclo)) PW001114
  • phospholipid biosynthesis (CL(16:0/10:0(3-OH)/16:0/10:0(3-OH))) PW001949
  • phospholipid biosynthesis (CL(16:0/12:0/12:0/12:0)) 2 PW001952
  • phospholipid biosynthesis (CL(16:0/14:0(3-OH)/16:0/14:0(3-OH))) PW001951
  • phospholipid biosynthesis (CL(16:0/16:0/16:0/16:0)) PW002010
  • phospholipid biosynthesis (CL(16:1(9Z)/10:0/14:0/14:0)) PW001954
  • phospholipid biosynthesis (CL(16:1(9Z)/12:0/12:0/12:0)) PW001955
  • phospholipid biosynthesis (CL(16:1(9Z)/14:0(3-OH)/16:1(9Z)/14:0(3-OH))) PW001958
  • phospholipid biosynthesis (CL(16:1(9Z)/17:0cycw7c/14:0/17:0cycw7c)) PW001959
  • phospholipid biosynthesis (CL(16:1(9Z)/18:1(9Z)/16:1(9Z)/14:0)) PW001759
  • phospholipid biosynthesis (CL(16:1(9Z)/19:0/16:0/16:0)) PW001961
  • phospholipid biosynthesis (CL(16:1(9Z)/19:0/16:1(9Z)/19:0)) PW001962
  • phospholipid biosynthesis (CL(16:1(9Z)/19:0cycv8c/16:1(9Z)/19:0cycv8c)) PW002017
  • phospholipid biosynthesis (CL(17:0/16:1(9Z)/14:0/14:0)) PW001963
  • phospholipid biosynthesis (CL(17:0/16:1(9Z)/16:0/16:0)) PW001964
  • phospholipid biosynthesis (CL(17:0cycw7c/10:0(3-OH)/14:0/14:0)) PW001966
  • phospholipid biosynthesis (CL(17:0cycw7c/10:0(3-OH)/17:0cycw7c/10:0(3-OH))) PW001967
  • phospholipid biosynthesis (CL(17:0cycw7c/10:0/14:0/14:0)) PW001968
  • phospholipid biosynthesis (CL(17:0cycw7c/12:0(3-OH)/12:0/12:0)) PW001969
  • phospholipid biosynthesis (CL(17:0cycw7c/12:0(3-OH)/17:0cycw7c/12:0(3-OH))) PW001970
  • phospholipid biosynthesis (CL(17:0cycw7c/16:1(9Z)/16:1(9Z)/14:0)) PW001694
  • phospholipid biosynthesis (CL(17:0cycw7c/16:1(9Z)/17:0cycw7c/16:1(9Z))) PW001696
  • phospholipid biosynthesis (CL(17:0cycw7c/16:1(9Z)/17:0cycw7c/17:0cycw7c)) PW001697
  • phospholipid biosynthesis (CL(17:0cycw7c/16:1(9Z)/17:0cycw7c/18:1(9Z))) PW001698
  • phospholipid biosynthesis (CL(17:0cycw7c/16:1(9Z)/18:1(9Z)/17:0cycw7c)) PW001700
  • phospholipid biosynthesis (CL(17:0cycw7c/17:0cycw7c/14:0/15:0cyclo)) PW001702
  • phospholipid biosynthesis (CL(17:0cycw7c/17:0cycw7c/14:0/17:0cycw7c)) PW001705
  • phospholipid biosynthesis (CL(17:0cycw7c/17:0cycw7c/14:0/19:0cycv8c)) PW001707
  • phospholipid biosynthesis (CL(17:0cycw7c/18:1(9Z)/14:0/18:1(9Z))) PW001712
  • phospholipid biosynthesis (CL(17:0cycw7c/18:1(9Z)/17:0cycw7c/17:0cycw7c)) PW001465
  • phospholipid biosynthesis (CL(17:0cycw7c/18:1(9Z)/17:0cycw7c/18:1(9Z))) PW001466
  • phospholipid biosynthesis (CL(17:0cycw7c/18:1(9Z)/18:1(9Z)/14:0)) PW001473
  • phospholipid biosynthesis (CL(17:0cycw7c/19:0cycv8c/14:0/14:0)) PW001475
  • phospholipid biosynthesis (CL(17:0cycw7c/19:0cycv8c/14:0/17:0cycw7c)) PW001476
  • phospholipid biosynthesis (CL(17:0cycw7c/19:0cycv8c/19:0cycv8c/14:0)) PW001485
  • phospholipid biosynthesis (CL(17:0cycw7c/19:iso/17:0cycw7c/19:iso)) PW001973
  • phospholipid biosynthesis (CL(18:0/10:0/10:0/10:0)) PW001974
  • phospholipid biosynthesis (CL(18:0/12:0/12:0/12:0)) PW001975
  • phospholipid biosynthesis (CL(18:1(11Z)/10:0/10:0/10:0)) PW001976
  • phospholipid biosynthesis (CL(18:1(11Z)/19:0/14:0/14:0)) PW001979
  • phospholipid biosynthesis (CL(18:1(11Z)/19:0/18:1(11Z)/19:0)) PW001980
  • phospholipid biosynthesis (CL(18:1(11Z)/19:0/19:0/19:0)) PW001981
  • phospholipid biosynthesis (CL(18:1(9Z)/12:0(3-OH)/18:1(9Z)/12:0(3-OH))) PW001982
  • phospholipid biosynthesis (CL(18:1(9Z)/14:0/14:0/14:0)) PW001493
  • phospholipid biosynthesis (CL(18:1(9Z)/14:0/14:0/18:1(9Z))) PW001494
  • phospholipid biosynthesis (CL(18:1(9Z)/14:0/17:0cycw7c/14:0)) PW001498
  • phospholipid biosynthesis (CL(18:1(9Z)/14:0/18:1(9Z)/14:0)) PW001500
  • phospholipid biosynthesis (CL(18:1(9Z)/14:0/19:0cycv8c/14:0)) PW001502
  • phospholipid biosynthesis (CL(18:1(9Z)/15:0cyclo/14:0/15:0cyclo) 5) PW001717
  • phospholipid biosynthesis (CL(18:1(9Z)/15:0cyclo/14:0/18:1(9Z))) PW001514
  • phospholipid biosynthesis (CL(18:1(9Z)/15:0cyclo/16:0/18:1(9Z))) PW001518
  • phospholipid biosynthesis (CL(18:1(9Z)/15:0cyclo/16:1(9Z)/18:1(9Z))) PW001519
  • phospholipid biosynthesis (CL(18:1(9Z)/15:0cyclo/17:0cycw7c/15:0cyclo)) PW001527
  • phospholipid biosynthesis (CL(18:1(9Z)/15:0cyclo/18:1(9Z)/15:0cyclo)) PW001531
  • phospholipid biosynthesis (CL(18:1(9Z)/15:0cyclo/18:1(9Z)/16:0)) PW001532
  • phospholipid biosynthesis (CL(18:1(9Z)/15:0cyclo/18:1(9Z)/16:1(9Z))) PW001533
  • phospholipid biosynthesis (CL(18:1(9Z)/15:0cyclo/18:1(9Z)/18:1(9Z))) PW001540
  • phospholipid biosynthesis (CL(18:1(9Z)/15:0cyclo/19:0cycv8c/19:0cycv8c)) PW001579
  • phospholipid biosynthesis (CL(18:1(9Z)/16:0/14:0/14:0)) PW001580
  • phospholipid biosynthesis (CL(18:1(9Z)/16:0/14:0/16:0)) PW001581
  • phospholipid biosynthesis (CL(18:1(9Z)/16:0/14:0/18:1(9Z))) PW001582
  • phospholipid biosynthesis (CL(18:1(9Z)/16:0/16:0/17:0cycw7c)) PW002012
  • phospholipid biosynthesis (CL(18:1(9Z)/16:0/16:0/19:0cycv8c) 2) PW001783
  • phospholipid biosynthesis (CL(18:1(9Z)/16:0/16:0/19:0cycv8c)) PW001583
  • phospholipid biosynthesis (CL(18:1(9Z)/16:0/17:0cycw7c/17:0cycw7c)) PW001585
  • phospholipid biosynthesis (CL(18:1(9Z)/16:0/17:0cycw7c/18:1(9Z))) PW001586
  • phospholipid biosynthesis (CL(18:1(9Z)/16:0/18:1(9Z)/14:0)) PW001587
  • phospholipid biosynthesis (CL(18:1(9Z)/16:0/18:1(9Z)/16:0)) PW001588
  • phospholipid biosynthesis (CL(18:1(9Z)/16:0/18:1(9Z)/16:1(9Z))) PW001594
  • phospholipid biosynthesis (CL(18:1(9Z)/16:0/18:1(9Z)/17:0cycw7c)) PW001595
  • phospholipid biosynthesis (CL(18:1(9Z)/16:0/18:1(9Z)/18:1(9Z))) PW001596
  • phospholipid biosynthesis (CL(18:1(9Z)/16:0/18:1(9Z)/19:0cycv8c)) PW001597
  • phospholipid biosynthesis (CL(18:1(9Z)/16:0/19:0cycv8c/16:0)) PW001598
  • phospholipid biosynthesis (CL(18:1(9Z)/16:0/19:0cycv8c/18:1(9Z))) PW001599
  • phospholipid biosynthesis (CL(18:1(9Z)/16:0/19:0cycv8c/19:0cycv8c)) PW001600
  • phospholipid biosynthesis (CL(18:1(9Z)/16:1(9Z)/14:0/14:0)) PW001601
  • phospholipid biosynthesis (CL(18:1(9Z)/16:1(9Z)/14:0/16:1(9Z))) PW001607
  • phospholipid biosynthesis (CL(18:1(9Z)/16:1(9Z)/14:0/18:1(9Z))) PW001608
  • phospholipid biosynthesis (CL(18:1(9Z)/16:1(9Z)/16:1(9Z)/14:0)) PW001609
  • phospholipid biosynthesis (CL(18:1(9Z)/16:1(9Z)/16:1(9Z)/17:0cycw7c)) PW001610
  • phospholipid biosynthesis (CL(18:1(9Z)/16:1(9Z)/16:1(9Z)/19:0cycv8c)) PW001612
  • phospholipid biosynthesis (CL(18:1(9Z)/16:1(9Z)/17:0cycw7c/16:1(9Z))) PW001613
  • phospholipid biosynthesis (CL(18:1(9Z)/16:1(9Z)/17:0cycw7c/17:0cycw7c)) PW001618
  • phospholipid biosynthesis (CL(18:1(9Z)/16:1(9Z)/17:0cycw7c/18:1(9Z))) PW001619
  • phospholipid biosynthesis (CL(18:1(9Z)/16:1(9Z)/18:1(9Z)/14:0)) PW001620
  • phospholipid biosynthesis (CL(18:1(9Z)/16:1(9Z)/18:1(9Z)/16:1(9Z))) PW001621
  • phospholipid biosynthesis (CL(18:1(9Z)/16:1(9Z)/18:1(9Z)/18:1(9Z))) PW001622
  • phospholipid biosynthesis (CL(18:1(9Z)/16:1(9Z)/18:1(9Z)/19:0cycv8c)) PW001623
  • phospholipid biosynthesis (CL(18:1(9Z)/16:1(9Z)/19:0cycv8c/16:1(9Z))) PW001629
  • phospholipid biosynthesis (CL(18:1(9Z)/16:1(9Z)/19:0cycv8c/18:1(9Z))) PW001630
  • phospholipid biosynthesis (CL(18:1(9Z)/16:1(9Z)/19:0cycv8c/19:0cycv8c)) PW001632
  • phospholipid biosynthesis (CL(18:1(9Z)/17:0cycw7c/14:0/18:1(9Z))) PW001635
  • phospholipid biosynthesis (CL(18:1(9Z)/17:0cycw7c/17:0cycw7c/18:1(9Z))) PW001644
  • phospholipid biosynthesis (CL(18:1(9Z)/17:0cycw7c/18:1(9Z)/14:0)) PW001646
  • phospholipid biosynthesis (CL(18:1(9Z)/17:0cycw7c/18:1(9Z)/17:0cycw7c)) PW001647
  • phospholipid biosynthesis (CL(18:1(9Z)/18:1(9Z)/14:0/14:0)) PW001649
  • phospholipid biosynthesis (CL(18:1(9Z)/18:1(9Z)/14:0/15:0cyclo)) PW001664
  • phospholipid biosynthesis (CL(18:1(9Z)/18:1(9Z)/14:0/16:0)) PW001665
  • phospholipid biosynthesis (CL(18:1(9Z)/18:1(9Z)/14:0/16:1(9Z))) PW001666
  • phospholipid biosynthesis (CL(18:1(9Z)/18:1(9Z)/14:0/17:0cycw7c)) PW001667
  • phospholipid biosynthesis (CL(18:1(9Z)/18:1(9Z)/14:0/18:1(9Z))) PW001668
  • phospholipid biosynthesis (CL(18:1(9Z)/18:1(9Z)/14:0/19:0cycv8c)) PW001669
  • phospholipid biosynthesis (CL(18:1(9Z)/18:1(9Z)/17:0cycw7c/14:0)) PW001670
  • phospholipid biosynthesis (CL(18:1(9Z)/18:1(9Z)/17:0cycw7c/16:0)) PW001672
  • phospholipid biosynthesis (CL(18:1(9Z)/18:1(9Z)/17:0cycw7c/16:1(9Z))) PW001673
  • phospholipid biosynthesis (CL(18:1(9Z)/18:1(9Z)/17:0cycw7c/17:0cycw7c)) PW001679
  • phospholipid biosynthesis (CL(18:1(9Z)/18:1(9Z)/17:0cycw7c/18:1(9Z))) PW001680
  • phospholipid biosynthesis (CL(18:1(9Z)/18:1(9Z)/17:0cycw7c/19:0cycv8c)) PW001685
  • phospholipid biosynthesis (CL(18:1(9Z)/18:1(9Z)/18:1(9Z)/14:0)) PW001686
  • phospholipid biosynthesis (CL(18:1(9Z)/18:1(9Z)/18:1(9Z)/17:0cycw7c)) PW001687
  • phospholipid biosynthesis (CL(18:1(9Z)/18:1(9Z)/18:1(9Z)/19:0cycv8c)) PW001026
  • phospholipid biosynthesis (CL(18:1(9Z)/18:1(9Z)/18:1(9Z)/19:0cycv8c)) 1440195714 PW001034
  • phospholipid biosynthesis (CL(18:1(9Z)/18:1(9Z)/18:1(9Z)/19:0cycv8c)) 2 PW001186
  • phospholipid biosynthesis (CL(18:1(9Z)/18:1(9Z)/19:0cycv8c/14:0)) PW001688
  • phospholipid biosynthesis (CL(18:1(9Z)/18:1(9Z)/19:0cycv8c/15:0cyclo)) PW001185
  • phospholipid biosynthesis (CL(18:1(9Z)/18:1(9Z)/19:0cycv8c/16:0)) PW001194
  • phospholipid biosynthesis (CL(18:1(9Z)/18:1(9Z)/19:0cycv8c/16:0)) 1442332377 PW001956
  • phospholipid biosynthesis (CL(18:1(9Z)/18:1(9Z)/19:0cycv8c/16:1(9Z)) PW001212
  • phospholipid biosynthesis (CL(18:1(9Z)/18:1(9Z)/19:0cycv8c/17:0cycw7c)) PW001210
  • phospholipid biosynthesis (CL(18:1(9Z)/19:0cycv8c/14:0/14:0)) PW001211
  • phospholipid biosynthesis (CL(18:1(9Z)/19:0cycv8c/14:0/18:1(9Z))) PW001233
  • phospholipid biosynthesis (CL(18:1(9Z)/19:0cycv8c/14:0/19:0cycv8c)) PW001234
  • phospholipid biosynthesis (CL(18:1(9Z)/19:0cycv8c/17:0cycw7c/17:0cycw7c)) PW001240
  • phospholipid biosynthesis (CL(18:1(9Z)/19:0cycv8c/17:0cycw7c/18:1(9Z))) PW001241
  • phospholipid biosynthesis (CL(18:1(9Z)/19:0cycv8c/18:1(9Z)/14:0)) PW001244
  • phospholipid biosynthesis (CL(18:1(9Z)/19:0cycv8c/18:1(9Z)/17:0cycw7c)) PW001248
  • phospholipid biosynthesis (CL(18:1(9Z)/19:0cycv8c/19:0cycv8c/14:0)) PW001249
  • phospholipid biosynthesis (CL(18:1/18:1/18:1/18:1)) PW001027
  • phospholipid biosynthesis (CL(19:0/16:1(9Z)/14:0/14:0)) PW001983
  • phospholipid biosynthesis (CL(19:0/16:1(9Z)/16:0/16:0)) PW001984
  • phospholipid biosynthesis (CL(19:0/16:1(9Z)/19:0/16:1(9Z))) PW001985
  • phospholipid biosynthesis (CL(19:0/18:1(11Z)/14:0/14:0)) PW001986
  • phospholipid biosynthesis (CL(19:0/18:1(11Z)/19:0/18:1(11Z))) PW001987
  • phospholipid biosynthesis (CL(19:0/18:1(11Z)/19:0/19:0)) PW001988
  • phospholipid biosynthesis (CL(19:0cycv8c/10:0(3-OH)/10:0/10:0)) PW001989
  • phospholipid biosynthesis (CL(19:0cycv8c/10:0(3-OH)/19:0cycv8c/10:0(3-OH))) PW001991
  • phospholipid biosynthesis (CL(19:0cycv8c/12:0(3-OH)/12:0/12:0)) PW001992
  • phospholipid biosynthesis (CL(19:0cycv8c/12:0(3-OH)/19:0cycv8c/12:0(3-OH))) PW001993
  • phospholipid biosynthesis (CL(19:0cycv8c/15:0cyclo/14:0/15:0cyclo)) PW001276
  • phospholipid biosynthesis (CL(19:0cycv8c/15:0cyclo/14:0/19:0cycv8c)) PW001291
  • phospholipid biosynthesis (CL(19:0cycv8c/15:0cyclo/17:0cycw7c/17:0cycw7c)) PW001302
  • phospholipid biosynthesis (CL(19:0cycv8c/15:0cyclo/19:0cycv8c/14:0)) PW001309
  • phospholipid biosynthesis (CL(19:0cycv8c/15:0cyclo/19:0cycv8c/16:0)) PW001316
  • phospholipid biosynthesis (CL(19:0cycv8c/16:0/14:0/14:0)) PW001320
  • phospholipid biosynthesis (CL(19:0cycv8c/16:0/14:0/16:0)) PW001321
  • phospholipid biosynthesis (CL(19:0cycv8c/16:0/16:0/14:0)) PW001323
  • phospholipid biosynthesis (CL(19:0cycv8c/16:0/16:0/17:0cycw7c)) PW001324
  • phospholipid biosynthesis (CL(19:0cycv8c/16:0/16:1(9Z)/19:0cycv8c)) PW001326
  • phospholipid biosynthesis (CL(19:0cycv8c/16:0/17:0cycw7c/16:0)) PW001331
  • phospholipid biosynthesis (CL(19:0cycv8c/16:0/17:0cycw7c/19:0cycv8c)) PW001333
  • phospholipid biosynthesis (CL(19:0cycv8c/16:0/18:1(9Z)/19:0cycv8c)) PW001334
  • phospholipid biosynthesis (CL(19:0cycv8c/16:0/19:0cycv8c/16:1(9Z))) PW001341
  • phospholipid biosynthesis (CL(19:0cycv8c/16:0/19:0cycv8c/17:0cycw7c)) PW001372
  • phospholipid biosynthesis (CL(19:0cycv8c/16:0/19:0cycv8c/18:1(9Z))) PW001373
  • phospholipid biosynthesis (CL(19:0cycv8c/16:1(9Z)/14:0/14:0)) PW001374
  • phospholipid biosynthesis (CL(19:0cycv8c/16:1(9Z)/14:0/16:1(9Z))) PW001375
  • phospholipid biosynthesis (CL(19:0cycv8c/16:1(9Z)/16:1(9Z)/14:0)) PW001377
  • phospholipid biosynthesis (CL(19:0cycv8c/16:1(9Z)/16:1(9Z)/17:0cycw7c)) PW001383
  • phospholipid biosynthesis (CL(19:0cycv8c/16:1(9Z)/17:0cycw7c/16:1(9Z))) PW001384
  • phospholipid biosynthesis (CL(19:0cycv8c/16:1(9Z)/17:0cycw7c/17:0cycw7c)) PW001385
  • phospholipid biosynthesis (CL(19:0cycv8c/16:1(9Z)/17:0cycw7c/19:0cycv8c)) PW001386
  • phospholipid biosynthesis (CL(19:0cycv8c/16:1(9Z)/18:1(9Z)/19:0cycv8c)) PW001387
  • phospholipid biosynthesis (CL(19:0cycv8c/17:0cycw7c/14:0/14:0)) PW001397
  • phospholipid biosynthesis (CL(19:0cycv8c/17:0cycw7c/14:0/17:0cycw7c)) PW001403
  • phospholipid biosynthesis (CL(19:0cycv8c/17:0cycw7c/17:0cycw7c/19:0cycv8c)) PW001406
  • phospholipid biosynthesis (CL(19:0cycv8c/18:1(9Z)/14:0/18:1(9Z))) PW001415
  • phospholipid biosynthesis (CL(19:0cycv8c/18:1(9Z)/17:0cycw7c/17:0cycw7c)) PW001422
  • phospholipid biosynthesis (CL(19:0cycv8c/18:1(9Z)/17:0cycw7c/18:1(9Z))) PW001423
  • phospholipid biosynthesis (CL(19:0cycv8c/18:1(9Z)/18:1(9Z)/14:0)) PW001424
  • phospholipid biosynthesis (CL(19:0cycv8c/18:1(9Z)/18:1(9Z)/17:0cycw7c)) PW001426
  • phospholipid biosynthesis (CL(19:0cycv8c/19:0cycv8c/14:0/14:0)) PW001432
  • phospholipid biosynthesis (CL(19:0cycv8c/19:0cycv8c/14:0/16:0)) PW001434
  • phospholipid biosynthesis (CL(19:0cycv8c/19:0cycv8c/14:0/18:1(9Z))) PW001438
  • phospholipid biosynthesis (CL(19:1(9Z)/16:1(9Z)/19:1(9Z)/16:1(9Z))) PW001995
  • phospholipid biosynthesis (CL(19:iso/10:0(3-OH)/10:0/10:0)) PW001996
  • phospholipid biosynthesis (CL(19:iso/10:0(3-OH)/19:iso/10:0(3-OH))) PW001997
  • phospholipid biosynthesis (CL(19:iso/10:0/19:iso/10:0)) PW001998
  • phospholipid biosynthesis (CL(19:iso/12:0(3-OH)/12:0/12:0)) PW001999
  • phospholipid biosynthesis (CL(19:iso/12:0(3-OH)/19:iso/12:0(3-OH))) PW002000
  • phospholipid biosynthesis (CL(19:iso/12:0/19:iso/12:0)) PW002001
  • phospholipid biosynthesis (CL(19:iso/14:0(3-OH)/14:0/14:0)) PW002002
  • phospholipid biosynthesis (CL(19:iso/14:0(3-OH)/19:iso/14:0(3-OH))) PW002004
  • phospholipid biosynthesis (CL(19:iso/14:0/14:0/14:0)) PW002005
  • phospholipid biosynthesis (CL(19:iso/14:0/19:iso/14:0)) PW002006
  • phospholipid biosynthesis (CL(19:iso/17:0cycw7c/19:0/19:0)) PW002007
  • phospholipid biosynthesis (CL(19:iso/19:0cycv8c/19:0/19:0)) PW002008
  • phospholipid biosynthesis (CL(19:iso/19:iso/19:iso/19:iso)) PW002009
  • phospholipid biosynthesis CL(14:0/15:0cyclo/14:0/17:0cycw7c) PW001029
  • phospholipid biosynthesis CL(14:0/16:0/14:0/14:0) PW001031
  • phospholipid biosynthesis CL(14:0/16:0/14:0/16:0) PW001032
  • phospholipid biosynthesis CL(14:0/16:0/14:0/16:1(9Z)) PW001871
  • phospholipid biosynthesis CL(14:0/16:0/14:0/18:1(9Z)) PW001033
  • phospholipid biosynthesis CL(14:0/16:0/14:0/19:0cycv8c) PW001035
  • phospholipid biosynthesis CL(14:0/16:0/16:1(9Z)/14:0) PW001036
  • phospholipid biosynthesis CL(14:0/16:0/18:1(9Z)/14:0) PW001037
  • phospholipid biosynthesis CL(14:0/16:0/19:0cycv8c/14:0) PW001038
  • phospholipid biosynthesis CL(14:0/16:1(9Z)/14:0/16:1(9Z)) PW001039
  • phospholipid biosynthesis CL(14:0/16:1(9Z)/14:0/18:1(9Z)) PW001040
  • phospholipid biosynthesis CL(14:0/16:1(9Z)/14:0/19:0cycv8c) PW001041
  • phospholipid biosynthesis CL(14:0/16:1(9Z)/18:1(9Z)/14:0) PW001042
  • phospholipid biosynthesis CL(14:0/16:1(9Z)/19:0cycv8c/14:0) PW001043
  • phospholipid biosynthesis CL(14:0/18:1(9Z)/14:0/14:0) PW001044
  • phospholipid biosynthesis CL(14:0/18:1(9Z)/14:0/17:0cycw7c) PW001045
  • phospholipid biosynthesis CL(14:0/18:1(9Z)/14:0/18:1(9Z)) PW001046
  • phospholipid biosynthesis CL(14:0/18:1(9Z)/14:0/19:0cycv8c) PW001047
  • phospholipid biosynthesis CL(14:0/18:1(9Z)/17:0cycw7c/14:0) PW001048
  • phospholipid biosynthesis CL(14:0/18:1(9Z)/19:0cycv8c/14:0) PW001049
  • phospholipid biosynthesis CL(14:0/19:0cycv8c/14:0/17:0cycw7c) PW001050
  • phospholipid biosynthesis CL(14:0/19:0cycv8c/14:0/19:0cycv8c) PW001051
  • phospholipid biosynthesis CL(14:0/19:0cycv8c/17:0cycw7c/14:0) PW001052
  • phospholipid biosynthesis CL(15:0cyclo/14:0/14:0/17:0cycw7c) PW001053
  • phospholipid biosynthesis CL(15:0cyclo/14:0/16:1(9Z)/16:1(9Z)) PW001054
  • phospholipid biosynthesis CL(15:0cyclo/14:0/17:0cycw7c/14:0) PW001055
  • phospholipid biosynthesis CL(15:0cyclo/14:0/17:0cycw7c/17:0cycw7c) PW001056
  • phospholipid biosynthesis CL(15:0cyclo/14:0/18:1(9Z)/18:1(9Z)) PW001057
  • phospholipid biosynthesis CL(15:0cyclo/14:0/19:0cycv8c/19:0cycv8c) PW001058
  • phospholipid biosynthesis CL(15:0cyclo/15:0cyclo/14:0/16:0) PW001059
  • phospholipid biosynthesis CL(15:0cyclo/15:0cyclo/14:0/16:1(9Z)) PW001060
  • phospholipid biosynthesis CL(15:0cyclo/15:0cyclo/14:0/18:1(9Z)) PW001061
  • phospholipid biosynthesis CL(15:0cyclo/15:0cyclo/14:0/19:0cycv8c) PW001062
  • phospholipid biosynthesis CL(15:0cyclo/15:0cyclo/16:0/14:0) PW001066
  • phospholipid biosynthesis CL(15:0cyclo/15:0cyclo/16:0/16:1(9Z)) PW001063
  • phospholipid biosynthesis CL(15:0cyclo/15:0cyclo/16:0/17:0cycw7c) PW001067
  • phospholipid biosynthesis CL(15:0cyclo/15:0cyclo/16:0/18:1(9Z)) PW001069
  • phospholipid biosynthesis CL(15:0cyclo/15:0cyclo/16:0/19:0cycv8c) PW001070
  • phospholipid biosynthesis CL(15:0cyclo/15:0cyclo/16:1(9Z)/14:0) PW001071
  • phospholipid biosynthesis CL(15:0cyclo/15:0cyclo/16:1(9Z)/16:0) PW001072
  • phospholipid biosynthesis CL(15:0cyclo/15:0cyclo/16:1(9Z)/16:1(9Z)) PW001068
  • phospholipid biosynthesis CL(15:0cyclo/15:0cyclo/16:1(9Z)/17:0cycw7c) PW001073
  • phospholipid biosynthesis CL(15:0cyclo/15:0cyclo/16:1(9Z)/18:1(9Z)) PW001074
  • phospholipid biosynthesis CL(15:0cyclo/15:0cyclo/16:1(9Z)/19:0cycv8c) PW001075
  • phospholipid biosynthesis CL(15:0cyclo/15:0cyclo/17:0cycw7c/16:0) PW001076
  • phospholipid biosynthesis CL(15:0cyclo/15:0cyclo/17:0cycw7c/16:1(9Z)) PW001077
  • phospholipid biosynthesis CL(15:0cyclo/15:0cyclo/17:0cycw7c/17:0cycw7c) PW001078
  • phospholipid biosynthesis CL(15:0cyclo/15:0cyclo/17:0cycw7c/18:1(9Z)) PW001079
  • phospholipid biosynthesis CL(15:0cyclo/15:0cyclo/17:0cycw7c/19:0cycv8c) PW001080
  • phospholipid biosynthesis CL(15:0cyclo/15:0cyclo/18:1(9Z)/14:0) PW001081
  • phospholipid biosynthesis CL(15:0cyclo/15:0cyclo/18:1(9Z)/16:1(9Z)) PW001083
  • phospholipid biosynthesis CL(15:0cyclo/15:0cyclo/18:1(9Z)/17:0cycw7c) PW001084
  • phospholipid biosynthesis CL(15:0cyclo/15:0cyclo/18:1(9Z)/18:1(9Z)) PW001085
  • phospholipid biosynthesis CL(15:0cyclo/15:0cyclo/18:1(9Z)/19:0cycv8c) PW001086
  • phospholipid biosynthesis CL(15:0cyclo/15:0cyclo/19:0cycv8c/14:0) PW001087
  • phospholipid biosynthesis CL(15:0cyclo/15:0cyclo/19:0cycv8c/15:0cyclo) PW001088
  • phospholipid biosynthesis CL(15:0cyclo/15:0cyclo/19:0cycv8c/16:0) PW001089
  • phospholipid biosynthesis CL(15:0cyclo/15:0cyclo/19:0cycv8c/16:1(9Z)) PW001090
  • phospholipid biosynthesis CL(15:0cyclo/15:0cyclo/19:0cycv8c/17:0cycw7c) PW001091
  • phospholipid biosynthesis CL(15:0cyclo/15:0cyclo/19:0cycv8c/18:1(9Z)) PW001092
  • phospholipid biosynthesis CL(15:0cyclo/15:0cyclo/19:0cycv8c/19:0cycv8c) PW001093
  • phospholipid biosynthesis CL(15:0cyclo/16:0/14:0/15:0cyclo) PW001094
  • phospholipid biosynthesis CL(15:0cyclo/16:0/15:0cyclo/14:0) PW001095
  • phospholipid biosynthesis CL(15:0cyclo/16:0/15:0cyclo/16:1(9Z)) PW001096
  • phospholipid biosynthesis CL(15:0cyclo/16:0/15:0cyclo/17:0cycw7c) PW001097
  • phospholipid biosynthesis CL(15:0cyclo/16:0/15:0cyclo/18:1(9Z)) PW001098
  • phospholipid biosynthesis CL(15:0cyclo/16:0/15:0cyclo/19:0cycv8c) PW001099
  • phospholipid biosynthesis CL(15:0cyclo/16:0/16:0/16:0) PW001100
  • phospholipid biosynthesis CL(15:0cyclo/16:0/16:0/16:1(9Z)) PW001102
  • phospholipid biosynthesis CL(15:0cyclo/16:0/16:0/17:0cycw7c) PW001103
  • phospholipid biosynthesis CL(15:0cyclo/16:0/16:0/18:1(9Z)) PW001104
  • phospholipid biosynthesis CL(15:0cyclo/16:0/16:0/19:0cycv8c) PW001105
  • phospholipid biosynthesis CL(15:0cyclo/16:0/16:1(9Z)/15:0cyclo) PW001107
  • phospholipid biosynthesis CL(15:0cyclo/16:0/16:1(9Z)/16:0) PW001106
  • phospholipid biosynthesis CL(15:0cyclo/16:0/16:1(9Z)/16:1(9Z)) PW001108
  • phospholipid biosynthesis CL(15:0cyclo/16:0/17:0cycw7c/15:0cyclo) PW001101
  • phospholipid biosynthesis CL(15:0cyclo/16:0/17:0cycw7c/16:0) PW001109
  • phospholipid biosynthesis CL(15:0cyclo/16:0/17:0cycw7c/17:0cycw7c) PW001110
  • phospholipid biosynthesis CL(15:0cyclo/16:0/18:1(9Z)/15:0cyclo) PW001111
  • phospholipid biosynthesis CL(15:0cyclo/16:0/18:1(9Z)/16:0) PW001112
  • phospholipid biosynthesis CL(15:0cyclo/16:0/18:1(9Z)/18:1(9Z)) PW001113
  • phospholipid biosynthesis CL(15:0cyclo/16:0/19:0cycv8c/16:0) PW001115
  • phospholipid biosynthesis CL(15:0cyclo/16:0/19:0cycv8c/19:0cycv8c) PW001116
  • phospholipid biosynthesis CL(15:0cyclo/16:1(9Z)/14:0/15:0cyclo) PW001117
  • phospholipid biosynthesis CL(15:0cyclo/16:1(9Z)/14:0/16:1(9Z)) PW001118
  • phospholipid biosynthesis CL(15:0cyclo/16:1(9Z)/15:0cyclo/14:0) PW001119
  • phospholipid biosynthesis CL(15:0cyclo/16:1(9Z)/15:0cyclo/16:1(9Z)) PW001120
  • phospholipid biosynthesis CL(15:0cyclo/16:1(9Z)/15:0cyclo/17:0cycw7c) PW001121
  • phospholipid biosynthesis CL(15:0cyclo/16:1(9Z)/15:0cyclo/18:1(9Z)) PW001122
  • phospholipid biosynthesis CL(15:0cyclo/16:1(9Z)/15:0cyclo/19:0cycv8c) PW001123
  • phospholipid biosynthesis CL(15:0cyclo/16:1(9Z)/16:0/16:0) PW001124
  • phospholipid biosynthesis CL(15:0cyclo/16:1(9Z)/16:0/16:1(9Z)) PW001125
  • phospholipid biosynthesis CL(15:0cyclo/16:1(9Z)/16:1(9Z)/14:0) PW001126
  • phospholipid biosynthesis CL(15:0cyclo/16:1(9Z)/16:1(9Z)/15:0cyclo) PW001127
  • phospholipid biosynthesis CL(15:0cyclo/16:1(9Z)/16:1(9Z)/16:0) PW001128
  • phospholipid biosynthesis CL(15:0cyclo/16:1(9Z)/16:1(9Z)/16:1(9Z)) PW001129
  • phospholipid biosynthesis CL(15:0cyclo/16:1(9Z)/16:1(9Z)/17:0cycw7c) PW001130
  • phospholipid biosynthesis CL(15:0cyclo/16:1(9Z)/16:1(9Z)/18:1(9Z)) PW001131
  • phospholipid biosynthesis CL(15:0cyclo/16:1(9Z)/16:1(9Z)/19:0cycv8c) PW001132
  • phospholipid biosynthesis CL(15:0cyclo/16:1(9Z)/17:0cycw7c/15:0cyclo) PW001133
  • phospholipid biosynthesis CL(15:0cyclo/16:1(9Z)/17:0cycw7c/16:1(9Z)) PW001134
  • phospholipid biosynthesis CL(15:0cyclo/16:1(9Z)/17:0cycw7c/17:0cycw7c) PW001135
  • phospholipid biosynthesis CL(15:0cyclo/16:1(9Z)/18:1(9Z)/15:0cyclo) PW001136
  • phospholipid biosynthesis CL(15:0cyclo/16:1(9Z)/18:1(9Z)/16:1(9Z)) PW001137
  • phospholipid biosynthesis CL(15:0cyclo/16:1(9Z)/18:1(9Z)/18:1(9Z)) PW001138
  • phospholipid biosynthesis CL(15:0cyclo/16:1(9Z)/19:0cycv8c/15:0cyclo) PW001139
  • phospholipid biosynthesis CL(15:0cyclo/16:1(9Z)/19:0cycv8c/16:1(9Z)) PW001140
  • phospholipid biosynthesis CL(15:0cyclo/16:1(9Z)/19:0cycv8c/19:0cycv8c) PW001141
  • phospholipid biosynthesis CL(15:0cyclo/17:0cycw7c/14:0/14:0) PW001142
  • phospholipid biosynthesis CL(15:0cyclo/17:0cycw7c/14:0/17:0cycw7c) PW001143
  • phospholipid biosynthesis CL(15:0cyclo/17:0cycw7c/15:0cyclo/17:0cycw7c) PW001144
  • phospholipid biosynthesis CL(15:0cyclo/17:0cycw7c/16:0/16:0) PW001145
  • phospholipid biosynthesis CL(15:0cyclo/17:0cycw7c/16:0/17:0cycw7c) PW001146
  • phospholipid biosynthesis CL(15:0cyclo/17:0cycw7c/16:1(9Z)/16:1(9Z)) PW001147
  • phospholipid biosynthesis CL(15:0cyclo/17:0cycw7c/16:1(9Z)/17:0cycw7c) PW001148
  • phospholipid biosynthesis CL(15:0cyclo/17:0cycw7c/17:0cycw7c)/16:0) PW001151
  • phospholipid biosynthesis CL(15:0cyclo/17:0cycw7c/17:0cycw7c/14:0) PW001149
  • phospholipid biosynthesis CL(15:0cyclo/17:0cycw7c/17:0cycw7c/15:0cyclo) PW001150
  • phospholipid biosynthesis CL(15:0cyclo/17:0cycw7c/17:0cycw7c/16:1(9Z)) PW001152
  • phospholipid biosynthesis CL(15:0cyclo/17:0cycw7c/17:0cycw7c/17:0cycw7c) PW001153
  • phospholipid biosynthesis CL(15:0cyclo/17:0cycw7c/17:0cycw7c/18:1(9Z)) PW001154
  • phospholipid biosynthesis CL(15:0cyclo/17:0cycw7c/17:0cycw7c/19:0cycv8c) PW001155
  • phospholipid biosynthesis CL(15:0cyclo/17:0cycw7c/18:1(9Z)/17:0cycw7c) PW001156
  • phospholipid biosynthesis CL(15:0cyclo/17:0cycw7c/18:1(9Z)/18:1(9Z)) PW001157
  • phospholipid biosynthesis CL(15:0cyclo/17:0cycw7c/19:0cycv8c/17:0cycw7c) PW001158
  • phospholipid biosynthesis CL(15:0cyclo/18:1(9Z)/14:0/15:0cyclo) PW001159
  • phospholipid biosynthesis CL(15:0cyclo/18:1(9Z)/14:0/18:1(9Z)) PW001160
  • phospholipid biosynthesis CL(15:0cyclo/18:1(9Z)/15:0cyclo/14:0) PW001161
  • phospholipid biosynthesis CL(15:0cyclo/18:1(9Z)/15:0cyclo/17:0cycw7c) PW001162
  • phospholipid biosynthesis CL(15:0cyclo/18:1(9Z)/15:0cyclo/18:1(9Z)) PW001163
  • phospholipid biosynthesis CL(15:0cyclo/18:1(9Z)/15:0cyclo/19:0cycv8c) PW001164
  • phospholipid biosynthesis CL(15:0cyclo/18:1(9Z)/16:0/16:0) PW001165
  • phospholipid biosynthesis CL(15:0cyclo/18:1(9Z)/16:0/18:1(9Z)) PW001166
  • phospholipid biosynthesis CL(15:0cyclo/18:1(9Z)/16:1(9Z)/16:1(9Z)) PW001167
  • phospholipid biosynthesis CL(15:0cyclo/18:1(9Z)/16:1(9Z)/18:1(9Z)) PW001168
  • phospholipid biosynthesis CL(15:0cyclo/18:1(9Z)/17:0cycw7c/15:0cyclo) PW001169
  • phospholipid biosynthesis CL(15:0cyclo/18:1(9Z)/17:0cycw7c/17:0cycw7c) PW001170
  • phospholipid biosynthesis CL(15:0cyclo/18:1(9Z)/17:0cycw7c/18:1(9Z)) PW001171
  • phospholipid biosynthesis CL(15:0cyclo/18:1(9Z)/18:1(9Z)/14:0) PW001172
  • phospholipid biosynthesis CL(15:0cyclo/18:1(9Z)/18:1(9Z)/15:0cyclo) PW001173
  • phospholipid biosynthesis CL(15:0cyclo/18:1(9Z)/18:1(9Z)/16:0) PW001174
  • phospholipid biosynthesis CL(15:0cyclo/18:1(9Z)/18:1(9Z)/16:1(9Z)) PW001175
  • phospholipid biosynthesis CL(15:0cyclo/18:1(9Z)/18:1(9Z)/17:0cycw7c) PW001176
  • phospholipid biosynthesis CL(15:0cyclo/18:1(9Z)/18:1(9Z)/18:1(9Z)) PW001177
  • phospholipid biosynthesis CL(15:0cyclo/18:1(9Z)/18:1(9Z)/19:0cycv8c) PW001178
  • phospholipid biosynthesis CL(15:0cyclo/18:1(9Z)/19:0cycv8c/15:0cyclo) PW001179
  • phospholipid biosynthesis CL(15:0cyclo/18:1(9Z)/19:0cycv8c/18:1(9Z)) PW001180
  • phospholipid biosynthesis CL(15:0cyclo/19:0cycv8c/14:0/15:0cyclo) PW001182
  • phospholipid biosynthesis CL(15:0cyclo/19:0cycv8c/14:0/19:0cycv8c) PW001183
  • phospholipid biosynthesis CL(15:0cyclo/19:0cycv8c/15:0cyclo/14:0) PW001184
  • phospholipid biosynthesis CL(15:0cyclo/19:0cycv8c/15:0cyclo/17:0cycw7c) PW001187
  • phospholipid biosynthesis CL(15:0cyclo/19:0cycv8c/15:0cyclo/19:0cycv8c) PW001188
  • phospholipid biosynthesis CL(15:0cyclo/19:0cycv8c/16:0/16:0) PW001189
  • phospholipid biosynthesis CL(15:0cyclo/19:0cycv8c/16:0/19:0cycv8c) PW001190
  • phospholipid biosynthesis CL(15:0cyclo/19:0cycv8c/16:1(9Z)/16:1(9Z)) PW001191
  • phospholipid biosynthesis CL(15:0cyclo/19:0cycv8c/16:1(9Z)/19:0cycv8c) PW001192
  • phospholipid biosynthesis CL(15:0cyclo/19:0cycv8c/17:0cycw7c/15:0cyclo) PW001193
  • phospholipid biosynthesis CL(15:0cyclo/19:0cycv8c/17:0cycw7c/17:0cycw7c) PW001195
  • phospholipid biosynthesis CL(15:0cyclo/19:0cycv8c/18:1(9Z)/18:1(9Z)) PW001196
  • phospholipid biosynthesis CL(15:0cyclo/19:0cycv8c/18:1(9Z)/19:0cycv8c) PW001197
  • phospholipid biosynthesis CL(15:0cyclo/19:0cycv8c/19:0cycv8c/14:0) PW001198
  • phospholipid biosynthesis CL(15:0cyclo/19:0cycv8c/19:0cycv8c/15:0cyclo) PW001199
  • phospholipid biosynthesis CL(15:0cyclo/19:0cycv8c/19:0cycv8c/16:0) PW001200
  • phospholipid biosynthesis CL(15:0cyclo/19:0cycv8c/19:0cycv8c/16:1(9Z)) PW001201
  • phospholipid biosynthesis CL(15:0cyclo/19:0cycv8c/19:0cycv8c/18:1(9Z)) PW001202
  • phospholipid biosynthesis CL(15:0cyclo/19:0cycv8c/19:0cycv8c/19:0cycv8c) PW001203
  • phospholipid biosynthesis CL(16:0/14:0/14:0/14:0) PW001204
  • phospholipid biosynthesis CL(16:0/14:0/14:0/16:0) PW001205
  • phospholipid biosynthesis CL(16:0/14:0/14:0/16:1(9Z)) PW001206
  • phospholipid biosynthesis CL(16:0/14:0/14:0/18:1(9Z)) PW001207
  • phospholipid biosynthesis CL(16:0/14:0/14:0/19:0cycv8c) PW001208
  • phospholipid biosynthesis CL(16:0/14:0/16:0/14:0) PW001209
  • phospholipid biosynthesis CL(16:0/14:0/16:1(9Z)/14:0) PW001213
  • phospholipid biosynthesis CL(16:0/14:0/16:1(9Z)/16:1(9Z)) PW001214
  • phospholipid biosynthesis CL(16:0/14:0/17:0cycw7c/17:0cycw7c) PW001215
  • phospholipid biosynthesis CL(16:0/14:0/18:1(9Z)/14:0) PW001216
  • phospholipid biosynthesis CL(16:0/14:0/18:1(9Z)/18:1(9Z)) PW001217
  • phospholipid biosynthesis CL(16:0/14:0/19:0cycv8c/14:0) PW001218
  • phospholipid biosynthesis CL(16:0/14:0/19:0cycv8c/19:0cycv8c) PW001219
  • phospholipid biosynthesis CL(16:0/15:0cyclo/14:0/15:0cyclo) PW001220
  • phospholipid biosynthesis CL(16:0/15:0cyclo/15:0cyclo/14:0) PW001221
  • phospholipid biosynthesis CL(16:0/15:0cyclo/15:0cyclo/16:1(9Z)) PW001222
  • phospholipid biosynthesis CL(16:0/15:0cyclo/15:0cyclo/17:0cycw7c) PW001223
  • phospholipid biosynthesis CL(16:0/15:0cyclo/15:0cyclo/18:1(9Z)) PW001224
  • phospholipid biosynthesis CL(16:0/15:0cyclo/15:0cyclo/19:0cycv8c) PW001225
  • phospholipid biosynthesis CL(16:0/15:0cyclo/16:0/16:0) PW001226
  • phospholipid biosynthesis CL(16:0/15:0cyclo/16:0/16:1(9Z)) PW001227
  • phospholipid biosynthesis CL(16:0/15:0cyclo/16:0/17:0cycw7c) PW001228
  • phospholipid biosynthesis CL(16:0/15:0cyclo/16:0/18:1(9Z)) PW001229
  • phospholipid biosynthesis CL(16:0/15:0cyclo/16:0/19:0cycv8c) PW001230
  • phospholipid biosynthesis CL(16:0/15:0cyclo/16:1(9Z)/15:0cyclo) PW001231
  • phospholipid biosynthesis CL(16:0/15:0cyclo/16:1(9Z)/16:0) PW001232
  • phospholipid biosynthesis CL(16:0/15:0cyclo/16:1(9Z)/16:1(9Z)) PW001235
  • phospholipid biosynthesis CL(16:0/15:0cyclo/17:0cycw7c/15:0cyclo) PW001236
  • phospholipid biosynthesis CL(16:0/15:0cyclo/17:0cycw7c/16:0) PW001237
  • phospholipid biosynthesis CL(16:0/15:0cyclo/17:0cycw7c/17:0cycw7c) PW001238
  • phospholipid biosynthesis CL(16:0/15:0cyclo/18:1(9Z)/15:0cyclo) PW001239
  • phospholipid biosynthesis CL(16:0/15:0cyclo/18:1(9Z)/16:0) PW001242
  • phospholipid biosynthesis CL(16:0/15:0cyclo/18:1(9Z)/18:1(9Z)) PW001243
  • phospholipid biosynthesis CL(16:0/15:0cyclo/19:0cycv8c/15:0cyclo) PW001245
  • phospholipid biosynthesis CL(16:0/15:0cyclo/19:0cycv8c/16:0) PW001246
  • phospholipid biosynthesis CL(16:0/15:0cyclo/19:0cycv8c/19:0cycv8c) PW001247
  • phospholipid biosynthesis CL(16:0/16:0/14:0/14:0) PW001250
  • phospholipid biosynthesis CL(16:0/16:0/14:0/16:1(9Z)) PW001252
  • phospholipid biosynthesis CL(16:0/16:0/14:0/17:0cycw7c) PW001254
  • phospholipid biosynthesis CL(16:0/16:0/14:0/18:1(9Z)) PW001255
  • phospholipid biosynthesis CL(16:0/16:0/14:0/19:0cycv8c) PW001256
  • phospholipid biosynthesis CL(16:0/16:0/16:0/17:0cycw7c) PW001257
  • phospholipid biosynthesis CL(16:0/16:0/16:0/18:1(9Z)) PW001258
  • phospholipid biosynthesis CL(16:0/16:0/16:0/19:0cycv8c) PW001259
  • phospholipid biosynthesis CL(16:0/16:0/16:1(9Z)/14:0) PW001260
  • phospholipid biosynthesis CL(16:0/16:0/16:1(9Z)/15:0cyclo) PW001261
  • phospholipid biosynthesis CL(16:0/16:0/16:1(9Z)/16:0) PW001264
  • phospholipid biosynthesis CL(16:0/16:0/16:1(9Z)/16:1(9Z)) PW001265
  • phospholipid biosynthesis CL(16:0/16:0/16:1(9Z)/17:0cycw7c) PW001267
  • phospholipid biosynthesis CL(16:0/16:0/16:1(9Z)/18:1(9Z)) PW001268
  • phospholipid biosynthesis CL(16:0/16:0/16:1(9Z)/19:0cycv8c) PW001269
  • phospholipid biosynthesis CL(16:0/16:0/17:0cycw7c/14:0) PW001270
  • phospholipid biosynthesis CL(16:0/16:0/17:0cycw7c/15:0cyclo) PW001271
  • phospholipid biosynthesis CL(16:0/16:0/17:0cycw7c/16:0) PW001272
  • phospholipid biosynthesis CL(16:0/16:0/17:0cycw7c/16:1(9Z)) PW001273
  • phospholipid biosynthesis CL(16:0/16:0/17:0cycw7c/17:0cycw7c) PW001274
  • phospholipid biosynthesis CL(16:0/16:0/17:0cycw7c/18:1(9Z)) PW001277
  • phospholipid biosynthesis CL(16:0/16:0/17:0cycw7c/19:0cycv8c) PW001278
  • phospholipid biosynthesis CL(16:0/16:0/18:1(9Z)/14:0) PW001266
  • phospholipid biosynthesis CL(16:0/16:0/18:1(9Z)/15:0cyclo) PW001279
  • phospholipid biosynthesis CL(16:0/16:0/18:1(9Z)/16:0) PW001280
  • phospholipid biosynthesis CL(16:0/16:0/18:1(9Z)/16:1(9Z)) PW001281
  • phospholipid biosynthesis CL(16:0/16:0/18:1(9Z)/17:0cycw7c) PW001282
  • phospholipid biosynthesis CL(16:0/16:0/18:1(9Z)/18:1(9Z)) PW001283
  • phospholipid biosynthesis CL(16:0/16:0/18:1(9Z)/19:0cycv8c) PW001284
  • phospholipid biosynthesis CL(16:0/16:0/19:0cycv8c/14:0) PW001285
  • phospholipid biosynthesis CL(16:0/16:0/19:0cycv8c/15:0cyclo) PW001286
  • phospholipid biosynthesis CL(16:0/16:0/19:0cycv8c/16:0) PW001287
  • phospholipid biosynthesis CL(16:0/16:0/19:0cycv8c/16:1(9Z)) PW001288
  • phospholipid biosynthesis CL(16:0/16:0/19:0cycv8c/17:0cycw7c) PW001289
  • phospholipid biosynthesis CL(16:0/16:0/19:0cycv8c/18:1(9Z)) PW001290
  • phospholipid biosynthesis CL(16:0/16:1(9Z)/14:0/14:0) PW001293
  • phospholipid biosynthesis CL(16:0/16:1(9Z)/14:0/16:0) PW001294
  • phospholipid biosynthesis CL(16:0/16:1(9Z)/14:0/16:1(9Z)) PW001295
  • phospholipid biosynthesis CL(16:0/16:1(9Z)/16:0/14:0) PW001296
  • phospholipid biosynthesis CL(16:0/16:1(9Z)/16:0/16:1(9Z)) PW001297
  • phospholipid biosynthesis CL(16:0/16:1(9Z)/16:0/17:0cycw7c) PW001303
  • phospholipid biosynthesis CL(16:0/16:1(9Z)/16:0/18:1(9Z)) PW001305
  • phospholipid biosynthesis CL(16:0/16:1(9Z)/16:0/19:0cycv8c) PW001306
  • phospholipid biosynthesis CL(16:0/16:1(9Z)/16:1(9Z)/14:0) PW001307
  • phospholipid biosynthesis CL(16:0/16:1(9Z)/16:1(9Z)/16:0) PW001308
  • phospholipid biosynthesis CL(16:0/16:1(9Z)/16:1(9Z)/16:1(9Z)) PW001311
  • phospholipid biosynthesis CL(16:0/16:1(9Z)/16:1(9Z)/17:0cycw7c) PW001312
  • phospholipid biosynthesis CL(16:0/16:1(9Z)/16:1(9Z)/18:1(9Z)) PW001313
  • phospholipid biosynthesis CL(16:0/16:1(9Z)/17:0cycw7c/16:0) PW001315
  • phospholipid biosynthesis CL(16:0/16:1(9Z)/17:0cycw7c/16:1(9Z)) PW001325
  • phospholipid biosynthesis CL(16:0/16:1(9Z)/17:0cycw7c/17:0cycw7c) PW001327
  • phospholipid biosynthesis CL(16:0/16:1(9Z)/18:1(9Z)/16:0) PW001328
  • phospholipid biosynthesis CL(16:0/16:1(9Z)/18:1(9Z)/16:1(9Z)) PW001329
  • phospholipid biosynthesis CL(16:0/16:1(9Z)/18:1(9Z)/18:1(9Z)) PW001330
  • phospholipid biosynthesis CL(16:0/16:1(9Z)/19:0cycv8c/16:0) PW001335
  • phospholipid biosynthesis CL(16:0/16:1(9Z)/19:0cycv8c/16:1(9Z)) PW001336
  • phospholipid biosynthesis CL(16:0/16:1(9Z)/19:0cycv8c/19:0cycv8c) PW001337
  • phospholipid biosynthesis CL(16:0/17:0cycw7c/14:0/16:0) PW001338
  • phospholipid biosynthesis CL(16:0/17:0cycw7c/14:0/17:0cycw7c) PW001339
  • phospholipid biosynthesis CL(16:0/17:0cycw7c/16:0/14:0) PW001342
  • phospholipid biosynthesis CL(16:0/17:0cycw7c/16:0/17:0cycw7c) PW001343
  • phospholipid biosynthesis CL(16:0/17:0cycw7c/16:1(9Z)/16:1(9Z)) PW001344
  • phospholipid biosynthesis CL(16:0/17:0cycw7c/16:1(9Z)/17:0cycw7c) PW001345
  • phospholipid biosynthesis CL(16:0/17:0cycw7c/17:0cycw7c/14:0) PW001346
  • phospholipid biosynthesis CL(16:0/17:0cycw7c/17:0cycw7c/16:1(9Z)) PW001347
  • phospholipid biosynthesis CL(16:0/17:0cycw7c/17:0cycw7c/17:0cycw7c) PW001351
  • phospholipid biosynthesis CL(16:0/17:0cycw7c/17:0cycw7c/18:1(9Z)) PW001348
  • phospholipid biosynthesis CL(16:0/17:0cycw7c/17:0cycw7c/19:0cycv8c) PW001349
  • phospholipid biosynthesis CL(16:0/17:0cycw7c/18:1(9Z)/17:0cycw7c) PW001350
  • phospholipid biosynthesis CL(16:0/17:0cycw7c/18:1(9Z)/18:1(9Z)) PW001352
  • phospholipid biosynthesis CL(16:0/17:0cycw7c/19:0cycv8c/17:0cycw7c) PW001353
  • phospholipid biosynthesis CL(16:0/18:1(9Z)/14:0/14:0) PW001355
  • phospholipid biosynthesis CL(16:0/18:1(9Z)/14:0/16:0) PW001356
  • phospholipid biosynthesis CL(16:0/18:1(9Z)/14:0/18:1(9Z)) PW001357
  • phospholipid biosynthesis CL(16:0/18:1(9Z)/16:0/14:0) PW001358
  • phospholipid biosynthesis CL(16:0/18:1(9Z)/16:0/17:0cycw7c) PW001359
  • phospholipid biosynthesis CL(16:0/18:1(9Z)/16:0/18:1(9Z)) PW001360
  • phospholipid biosynthesis CL(16:0/18:1(9Z)/16:0/19:0cycv8c) PW001361
  • phospholipid biosynthesis CL(16:0/18:1(9Z)/16:1(9Z)/16:1(9Z)) PW001362
  • phospholipid biosynthesis CL(16:0/18:1(9Z)/16:1(9Z)/18:1(9Z)) PW001363
  • phospholipid biosynthesis CL(16:0/18:1(9Z)/17:0cycw7c/16:0) PW001364
  • phospholipid biosynthesis CL(16:0/18:1(9Z)/17:0cycw7c/17:0cycw7c) PW001365
  • phospholipid biosynthesis CL(16:0/18:1(9Z)/17:0cycw7c/18:1(9Z)) PW001366
  • phospholipid biosynthesis CL(16:0/18:1(9Z)/18:1(9Z)/14:0) PW001367
  • phospholipid biosynthesis CL(16:0/18:1(9Z)/18:1(9Z)/16:0) PW001368
  • phospholipid biosynthesis CL(16:0/18:1(9Z)/18:1(9Z)/16:1(9Z)) PW001369
  • phospholipid biosynthesis CL(16:0/18:1(9Z)/18:1(9Z)/17:0cycw7c) PW001370
  • phospholipid biosynthesis CL(16:0/18:1(9Z)/18:1(9Z)/18:1(9Z)) PW001371
  • phospholipid biosynthesis CL(16:0/18:1(9Z)/18:1(9Z)/19:0cycv8c) PW001378
  • phospholipid biosynthesis CL(16:0/18:1(9Z)/19:0cycv8c/16:0) PW001379
  • phospholipid biosynthesis CL(16:0/18:1(9Z)/19:0cycv8c/18:1(9Z)) PW001380
  • phospholipid biosynthesis CL(16:0/18:1(9Z)/19:0cycv8c/19:0cycv8c) PW001381
  • phospholipid biosynthesis CL(16:0/19:0cycv8c/14:0/14:0) PW001382
  • phospholipid biosynthesis CL(16:0/19:0cycv8c/14:0/16:0) PW001389
  • phospholipid biosynthesis CL(16:0/19:0cycv8c/14:0/19:0cycv8c) PW001390
  • phospholipid biosynthesis CL(16:0/19:0cycv8c/16:0/14:0) PW001391
  • phospholipid biosynthesis CL(16:0/19:0cycv8c/16:0/17:0cycw7c) PW001392
  • phospholipid biosynthesis CL(16:0/19:0cycv8c/16:1(9Z)/16:1(9Z)) PW001393
  • phospholipid biosynthesis CL(16:0/19:0cycv8c/16:1(9Z)/19:0cycv8c) PW001398
  • phospholipid biosynthesis CL(16:0/19:0cycv8c/17:0cycw7c/16:0) PW001399
  • phospholipid biosynthesis CL(16:0/19:0cycv8c/17:0cycw7c/17:0cycw7c) PW001400
  • phospholipid biosynthesis CL(16:0/19:0cycv8c/17:0cycw7c/19:0cycv8c) PW001401
  • phospholipid biosynthesis CL(16:0/19:0cycv8c/18:1(9Z)/18:1(9Z)) PW001402
  • phospholipid biosynthesis CL(16:0/19:0cycv8c/18:1(9Z)/19:0cycv8c) PW001409
  • phospholipid biosynthesis CL(16:0/19:0cycv8c/19:0cycv8c/14:0) PW001410
  • phospholipid biosynthesis CL(16:0/19:0cycv8c/19:0cycv8c/16:1(9Z)) PW001411
  • phospholipid biosynthesis CL(16:0/19:0cycv8c/19:0cycv8c/17:0cycw7c) PW001412
  • phospholipid biosynthesis CL(16:0/19:0cycv8c/19:0cycv8c/18:1(9Z)) PW001413
  • phospholipid biosynthesis CL(16:1(9Z)/14:0/14:0/16:1(9Z)) PW001416
  • phospholipid biosynthesis CL(16:1(9Z)/14:0/14:0/18:1(9Z)) PW001417
  • phospholipid biosynthesis CL(16:1(9Z)/14:0/14:0/19:0cycv8c) PW001418
  • phospholipid biosynthesis CL(16:1(9Z)/14:0/16:1(9Z)/14:0) PW001419
  • phospholipid biosynthesis CL(16:1(9Z)/14:0/17:0cycw7c/17:0cycw7c) PW001421
  • phospholipid biosynthesis CL(16:1(9Z)/14:0/18:1(9Z)/14:0) PW001425
  • phospholipid biosynthesis CL(16:1(9Z)/14:0/18:1(9Z)/18:1(9Z)) PW001427
  • phospholipid biosynthesis CL(16:1(9Z)/14:0/19:0cycv8c/14:0) PW001429
  • phospholipid biosynthesis CL(16:1(9Z)/14:0/19:0cycv8c/19:0cycv8c) PW001430
  • phospholipid biosynthesis CL(16:1(9Z)/15:0cyclo/14:0/15:0cyclo) PW001431
  • phospholipid biosynthesis CL(16:1(9Z)/15:0cyclo/14:0/16:1(9Z)) PW001437
  • phospholipid biosynthesis CL(16:1(9Z)/15:0cyclo/15:0cyclo/14:0) ) PW001724
  • phospholipid biosynthesis CL(16:1(9Z)/15:0cyclo/15:0cyclo/17:0cycw7c) PW001440
  • phospholipid biosynthesis CL(16:1(9Z)/15:0cyclo/15:0cyclo/18:1(9Z)) PW001441
  • phospholipid biosynthesis CL(16:1(9Z)/15:0cyclo/15:0cyclo/19:0cycv8c) PW001442
  • phospholipid biosynthesis CL(16:1(9Z)/15:0cyclo/16:0/16:1(9Z)) PW001449
  • phospholipid biosynthesis CL(16:1(9Z)/15:0cyclo/16:1(9Z)/14:0) PW001450
  • phospholipid biosynthesis CL(16:1(9Z)/15:0cyclo/16:1(9Z)/15:0cyclo) PW001451
  • phospholipid biosynthesis CL(16:1(9Z)/15:0cyclo/16:1(9Z)/16:0) PW001452
  • phospholipid biosynthesis CL(16:1(9Z)/15:0cyclo/16:1(9Z)/16:1(9Z)) PW001453
  • phospholipid biosynthesis CL(16:1(9Z)/15:0cyclo/16:1(9Z)/18:1(9Z)) PW001455
  • phospholipid biosynthesis CL(16:1(9Z)/15:0cyclo/16:1(9Z)/19:0cycv8c) PW001456
  • phospholipid biosynthesis CL(16:1(9Z)/15:0cyclo/17:0cycw7c/15:0cyclo) PW001457
  • phospholipid biosynthesis CL(16:1(9Z)/15:0cyclo/17:0cycw7c/16:1(9Z)) PW001458
  • phospholipid biosynthesis CL(16:1(9Z)/15:0cyclo/17:0cycw7c/17:0cycw7c) PW001459
  • phospholipid biosynthesis CL(16:1(9Z)/15:0cyclo/18:1(9Z)/15:0cyclo) PW001460
  • phospholipid biosynthesis CL(16:1(9Z)/15:0cyclo/18:1(9Z)/16:1(9Z)) PW001461
  • phospholipid biosynthesis CL(16:1(9Z)/15:0cyclo/18:1(9Z)/18:1(9Z)) PW001462
  • phospholipid biosynthesis CL(16:1(9Z)/15:0cyclo/19:0cycv8c/15:0cyclo) PW001463
  • phospholipid biosynthesis CL(16:1(9Z)/15:0cyclo/19:0cycv8c/16:1(9Z)) PW001468
  • phospholipid biosynthesis CL(16:1(9Z)/15:0cyclo/19:0cycv8c/19:0cycv8c) PW001469
  • phospholipid biosynthesis CL(16:1(9Z)/16:0/14:0/14:0) PW001470
  • phospholipid biosynthesis CL(16:1(9Z)/16:0/14:0/16:0) PW001471
  • phospholipid biosynthesis CL(16:1(9Z)/16:0/14:0/16:1(9Z)) PW001472
  • phospholipid biosynthesis CL(16:1(9Z)/16:0/16:0/14:0) PW001477
  • phospholipid biosynthesis CL(16:1(9Z)/16:0/16:0/17:0cycw7c) PW001478
  • phospholipid biosynthesis CL(16:1(9Z)/16:0/16:0/18:1(9Z)) PW001479
  • phospholipid biosynthesis CL(16:1(9Z)/16:0/16:0/19:0cycv8c) PW001480
  • phospholipid biosynthesis CL(16:1(9Z)/16:0/16:1(9Z)/14:0) PW001481
  • phospholipid biosynthesis CL(16:1(9Z)/16:0/16:1(9Z)/16:0) PW001486
  • phospholipid biosynthesis CL(16:1(9Z)/16:0/16:1(9Z)/16:1(9Z)) PW001487
  • phospholipid biosynthesis CL(16:1(9Z)/16:0/16:1(9Z)/17:0cycw7c) PW001488
  • phospholipid biosynthesis CL(16:1(9Z)/16:0/16:1(9Z)/18:1(9Z)) PW001489
  • phospholipid biosynthesis CL(16:1(9Z)/16:0/16:1(9Z)/19:0cycv8c) PW001490
  • phospholipid biosynthesis CL(16:1(9Z)/16:0/17:0cycw7c/16:0) PW001491
  • phospholipid biosynthesis CL(16:1(9Z)/16:0/17:0cycw7c/16:1(9Z)) PW001496
  • phospholipid biosynthesis CL(16:1(9Z)/16:0/17:0cycw7c/17:0cycw7c) PW001497
  • phospholipid biosynthesis CL(16:1(9Z)/16:0/18:1(9Z)/16:0) PW001501
  • phospholipid biosynthesis CL(16:1(9Z)/16:0/18:1(9Z)/16:1(9Z)) PW001503
  • phospholipid biosynthesis CL(16:1(9Z)/16:0/18:1(9Z)/18:1(9Z)) PW001504
  • phospholipid biosynthesis CL(16:1(9Z)/16:0/19:0cycv8c/16:0) PW001505
  • phospholipid biosynthesis CL(16:1(9Z)/16:0/19:0cycv8c/16:1(9Z)) PW001508
  • phospholipid biosynthesis CL(16:1(9Z)/16:0/19:0cycv8c/19:0cycv8c) PW001509
  • phospholipid biosynthesis CL(16:1(9Z)/16:1(9Z)/14:0/14:0) PW001510
  • phospholipid biosynthesis CL(16:1(9Z)/16:1(9Z)/14:0/15:0cyclo) PW001511
  • phospholipid biosynthesis CL(16:1(9Z)/16:1(9Z)/14:0/16:0) PW001512
  • phospholipid biosynthesis CL(16:1(9Z)/16:1(9Z)/14:0/16:1(9Z)) PW001513
  • phospholipid biosynthesis CL(16:1(9Z)/16:1(9Z)/14:0/17:0cycw7c) PW001520
  • phospholipid biosynthesis CL(16:1(9Z)/16:1(9Z)/14:0/18:1(9Z)) PW001521
  • phospholipid biosynthesis CL(16:1(9Z)/16:1(9Z)/14:0/19:0cycv8c) PW001522
  • phospholipid biosynthesis CL(16:1(9Z)/16:1(9Z)/16:1(9Z)/14:0) PW001523
  • phospholipid biosynthesis CL(16:1(9Z)/16:1(9Z)/16:1(9Z)/17:0cycw7c) PW001524
  • phospholipid biosynthesis CL(16:1(9Z)/16:1(9Z)/16:1(9Z)/18:1(9Z)) PW001525
  • phospholipid biosynthesis CL(16:1(9Z)/16:1(9Z)/16:1(9Z)/19:0cycv8c) PW001526
  • phospholipid biosynthesis CL(16:1(9Z)/16:1(9Z)/17:0cycw7c/14:0) PW001535
  • phospholipid biosynthesis CL(16:1(9Z)/16:1(9Z)/17:0cycw7c/15:0cyclo) PW001536
  • phospholipid biosynthesis CL(16:1(9Z)/16:1(9Z)/17:0cycw7c/16:0) PW001537
  • phospholipid biosynthesis CL(16:1(9Z)/16:1(9Z)/17:0cycw7c/16:1(9Z)) PW001538
  • phospholipid biosynthesis CL(16:1(9Z)/16:1(9Z)/17:0cycw7c/17:0cycw7c) PW001539
  • phospholipid biosynthesis CL(16:1(9Z)/16:1(9Z)/17:0cycw7c/18:1(9Z)) PW001542
  • phospholipid biosynthesis CL(16:1(9Z)/16:1(9Z)/17:0cycw7c/19:0cycv8c) PW001543
  • phospholipid biosynthesis CL(16:1(9Z)/16:1(9Z)/18:1(9Z)/14:0) PW001544
  • phospholipid biosynthesis CL(16:1(9Z)/16:1(9Z)/18:1(9Z)/15:0cyclo) PW001545
  • phospholipid biosynthesis CL(16:1(9Z)/16:1(9Z)/18:1(9Z)/16:0) PW001546
  • phospholipid biosynthesis CL(16:1(9Z)/16:1(9Z)/18:1(9Z)/16:1(9Z)) PW001547
  • phospholipid biosynthesis CL(16:1(9Z)/16:1(9Z)/18:1(9Z)/17:0cycw7c) PW001548
  • phospholipid biosynthesis CL(16:1(9Z)/16:1(9Z)/18:1(9Z)/18:1(9Z)) PW001549
  • phospholipid biosynthesis CL(16:1(9Z)/16:1(9Z)/18:1(9Z)/19:0cycv8c) PW001550
  • phospholipid biosynthesis CL(16:1(9Z)/16:1(9Z)/19:0cycv8c/14:0) PW001551
  • phospholipid biosynthesis CL(16:1(9Z)/16:1(9Z)/19:0cycv8c/15:0cyclo) PW001552
  • phospholipid biosynthesis CL(16:1(9Z)/16:1(9Z)/19:0cycv8c/16:0) PW001553
  • phospholipid biosynthesis CL(16:1(9Z)/16:1(9Z)/19:0cycv8c/16:1(9Z)) PW001554
  • phospholipid biosynthesis CL(16:1(9Z)/16:1(9Z)/19:0cycv8c/17:0cycw7c) PW001555
  • phospholipid biosynthesis CL(16:1(9Z)/16:1(9Z)/19:0cycv8c/18:1(9Z)) PW001556
  • phospholipid biosynthesis CL(16:1(9Z)/16:1(9Z)/19:0cycv8c/19:0cycv8c) PW001557
  • phospholipid biosynthesis CL(16:1(9Z)/17:0cycw7c/14:0/16:1(9Z)) PW001558
  • phospholipid biosynthesis CL(16:1(9Z)/17:0cycw7c/14:0/17:0cycw7c) PW001559
  • phospholipid biosynthesis CL(16:1(9Z)/17:0cycw7c/16:1(9Z)/14:0) PW001560
  • phospholipid biosynthesis CL(16:1(9Z)/17:0cycw7c/16:1(9Z)/17:0cycw7c) PW001561
  • phospholipid biosynthesis CL(16:1(9Z)/17:0cycw7c/17:0cycw7c/14:0) PW001562
  • phospholipid biosynthesis CL(16:1(9Z)/17:0cycw7c/17:0cycw7c/16:1(9Z)) PW001563
  • phospholipid biosynthesis CL(16:1(9Z)/17:0cycw7c/17:0cycw7c/17:0cycw7c) PW001564
  • phospholipid biosynthesis CL(16:1(9Z)/17:0cycw7c/17:0cycw7c/18:1(9Z)) PW001565
  • phospholipid biosynthesis CL(16:1(9Z)/17:0cycw7c/17:0cycw7c/19:0cycv8c) PW001566
  • phospholipid biosynthesis CL(16:1(9Z)/17:0cycw7c/18:1(9Z)/17:0cycw7c) PW001567
  • phospholipid biosynthesis CL(16:1(9Z)/17:0cycw7c/18:1(9Z)/18:1(9Z)) PW001568
  • phospholipid biosynthesis CL(16:1(9Z)/17:0cycw7c/19:0cycv8c/17:0cycw7c) PW001569
  • phospholipid biosynthesis CL(16:1(9Z)/17:0cycw7c/19:0cycv8c/19:0cycv8c) PW001570
  • phospholipid biosynthesis CL(16:1(9Z)/18:1(9Z)/14:0/14:0) PW001571
  • phospholipid biosynthesis CL(16:1(9Z)/18:1(9Z)/14:0/16:1(9Z)) PW001572
  • phospholipid biosynthesis CL(16:1(9Z)/18:1(9Z)/14:0/18:1(9Z)) PW001573
  • phospholipid biosynthesis CL(16:1(9Z)/18:1(9Z)/16:1(9Z)/14:0) PW001574
  • phospholipid biosynthesis CL(16:1(9Z)/18:1(9Z)/16:1(9Z)/17:0cycw7c) PW001575
  • phospholipid biosynthesis CL(16:1(9Z)/18:1(9Z)/16:1(9Z)/18:1(9Z)) PW001576
  • phospholipid biosynthesis CL(16:1(9Z)/18:1(9Z)/16:1(9Z)/19:0cycv8c) PW001589
  • phospholipid biosynthesis CL(16:1(9Z)/18:1(9Z)/17:0cycw7c/16:1(9Z)) PW001590
  • phospholipid biosynthesis CL(16:1(9Z)/18:1(9Z)/17:0cycw7c/17:0cycw7c) PW001591
  • phospholipid biosynthesis CL(16:1(9Z)/18:1(9Z)/17:0cycw7c/18:1(9Z)) PW001592
  • phospholipid biosynthesis CL(16:1(9Z)/18:1(9Z)/18:1(9Z)/14:0) PW001593
  • phospholipid biosynthesis CL(16:1(9Z)/18:1(9Z)/18:1(9Z)/16:1(9Z)) PW001602
  • phospholipid biosynthesis CL(16:1(9Z)/18:1(9Z)/18:1(9Z)/17:0cycw7c) PW001603
  • phospholipid biosynthesis CL(16:1(9Z)/18:1(9Z)/18:1(9Z)/18:1(9Z)) PW001604
  • phospholipid biosynthesis CL(16:1(9Z)/18:1(9Z)/18:1(9Z)/19:0cycv8c) PW001605
  • phospholipid biosynthesis CL(16:1(9Z)/18:1(9Z)/19:0cycv8c/16:1(9Z)) PW001606
  • phospholipid biosynthesis CL(16:1(9Z)/18:1(9Z)/19:0cycv8c/18:1(9Z)) PW001611
  • phospholipid biosynthesis CL(16:1(9Z)/18:1(9Z)/19:0cycv8c/19:0cycv8c) PW001614
  • phospholipid biosynthesis CL(16:1(9Z)/19:0cycv8c/14:0/14:0) PW001615
  • phospholipid biosynthesis CL(16:1(9Z)/19:0cycv8c/14:0/16:1(9Z)) PW001616
  • phospholipid biosynthesis CL(16:1(9Z)/19:0cycv8c/14:0/19:0cycv8c) PW001617
  • phospholipid biosynthesis CL(16:1(9Z)/19:0cycv8c/16:1(9Z)/14:0) PW001624
  • phospholipid biosynthesis CL(16:1(9Z)/19:0cycv8c/16:1(9Z)/17:0cycw7c) PW001625
  • phospholipid biosynthesis CL(16:1(9Z)/19:0cycv8c/16:1(9Z)/19:0cycv8c) PW001626
  • phospholipid biosynthesis CL(16:1(9Z)/19:0cycv8c/17:0cycw7c/16:1(9Z)) PW001627
  • phospholipid biosynthesis CL(16:1(9Z)/19:0cycv8c/17:0cycw7c/17:0cycw7c) PW001628
  • phospholipid biosynthesis CL(16:1(9Z)/19:0cycv8c/17:0cycw7c/19:0cycv8c) PW001631
  • phospholipid biosynthesis CL(16:1(9Z)/19:0cycv8c/18:1(9Z)/18:1(9Z)) PW001636
  • phospholipid biosynthesis CL(16:1(9Z)/19:0cycv8c/18:1(9Z)/19:0cycv8c) PW001637
  • phospholipid biosynthesis CL(16:1(9Z)/19:0cycv8c/19:0cycv8c/14:0) PW001639
  • phospholipid biosynthesis CL(16:1(9Z)/19:0cycv8c/19:0cycv8c/16:1(9Z)) PW001641
  • phospholipid biosynthesis CL(16:1(9Z)/19:0cycv8c/19:0cycv8c/17:0cycw7c) PW001642
  • phospholipid biosynthesis CL(16:1(9Z)/19:0cycv8c/19:0cycv8c/18:1(9Z)) PW001643
  • phospholipid biosynthesis CL(17:0cycw7c/15:0cyclo/14:0/14:0) PW001650
  • phospholipid biosynthesis CL(17:0cycw7c/15:0cyclo/16:0/17:0cycw7c) PW001652
  • phospholipid biosynthesis CL(17:0cycw7c/15:0cyclo/16:1(9Z)/17:0cycw7c) PW001653
  • phospholipid biosynthesis CL(17:0cycw7c/15:0cyclo/17:0cycw7c/14:0) PW001654
  • phospholipid biosynthesis CL(17:0cycw7c/15:0cyclo/17:0cycw7c/15:0cyclo) PW001655
  • phospholipid biosynthesis CL(17:0cycw7c/15:0cyclo/17:0cycw7c/16:0) PW001656
  • phospholipid biosynthesis CL(17:0cycw7c/15:0cyclo/17:0cycw7c/16:1(9Z)) PW001657
  • phospholipid biosynthesis CL(17:0cycw7c/15:0cyclo/17:0cycw7c/17:0cycw7c) PW001658
  • phospholipid biosynthesis CL(17:0cycw7c/15:0cyclo/17:0cycw7c/18:1(9Z)) PW001659
  • phospholipid biosynthesis CL(17:0cycw7c/15:0cyclo/17:0cycw7c/19:0cycv8c) PW001660
  • phospholipid biosynthesis CL(17:0cycw7c/15:0cyclo/18:1(9Z)/17:0cycw7c) PW001661
  • phospholipid biosynthesis CL(17:0cycw7c/15:0cyclo/19:0cycv8c/17:0cycw7c) PW001662
  • phospholipid biosynthesis CL(17:0cycw7c/16:0/14:0/16:0) PW001663
  • phospholipid biosynthesis CL(17:0cycw7c/16:0/14:0/17:0cycw7c) PW001674
  • phospholipid biosynthesis CL(17:0cycw7c/16:0/16:0/14:0) PW001675
  • phospholipid biosynthesis CL(17:0cycw7c/16:0/16:0/17:0cycw7c) PW001676
  • phospholipid biosynthesis CL(17:0cycw7c/16:0/16:1(9Z)/17:0cycw7c) PW001677
  • phospholipid biosynthesis CL(17:0cycw7c/16:0/17:0cycw7c/14:0) PW001678
  • phospholipid biosynthesis CL(17:0cycw7c/16:0/17:0cycw7c/16:0) PW001681
  • phospholipid biosynthesis CL(17:0cycw7c/16:0/17:0cycw7c/16:1(9Z)) PW001682
  • phospholipid biosynthesis CL(17:0cycw7c/16:0/17:0cycw7c/17:0cycw7c) PW001683
  • phospholipid biosynthesis CL(17:0cycw7c/16:0/17:0cycw7c/18:1(9Z)) PW001684
  • phospholipid biosynthesis CL(17:0cycw7c/16:0/17:0cycw7c/19:0cycv8c) PW001689
  • phospholipid biosynthesis CL(17:0cycw7c/16:0/18:1(9Z)/17:0cycw7c) PW001690
  • phospholipid biosynthesis CL(17:0cycw7c/16:0/19:0cycv8c/17:0cycw7c) PW001691
  • phospholipid biosynthesis CL(17:0cycw7c/16:1(9Z)/14:0/16:1(9Z)) PW001693
  • phospholipid biosynthesis I (18:0, 18:0) PW001001
  • phospholipid biosynthesis I (CL(18:2(9Z,12Z)/18:2(9Z,12Z)/18:2(9Z,12Z)/18:2(9Z,12Z))¬†) PW001025
  • phospholipid biosynthesisCL(16:0/16:1(9Z)/16:1(9Z)/19:0cycv8c) PW001314
  • phospholipid biosynthesisCL(16:1(9Z)/15:0cyclo/16:1(9Z)/17:0cycw7c) PW001454
KEGG Pathways:
KEGG Reactions:
1.0Thumb+1.0Thumb1.0Phosphatidylglycerol+1.0Thumb+1.0Thumb
1.0Phosphatidylglycerophosphate + 1.0Water ↔ 1.0Phosphatidylglycerol + 1.0Phosphate + 1.0PG(16:0/16:0)
ReactionCard
SMPDB Reactions:
1.0Thumb+1.0an L-1-phosphatidylethanolamine ? 1.0Thumb+1.0an L-1-phosphatidyl-glycerol 
1.0Water + 1.0an L-1-phosphatidylethanolamine ? 1.0Phosphate + 1.0an L-1-phosphatidyl-glycerol 
ReactionCard
1.0Thumb+1.0Thumb1.0Thumb+1.0Thumb
1.0Thumb+1.0Thumb1.0Thumb+1.0Thumb
1.0Thumb+1.0Thumb1.0Thumb+1.0Thumb
1.0Thumb+1.0Thumb1.0Thumb+1.0Thumb
1.0PGP(18:1(11Z)/16:0)+1.0Thumb1.0Thumb+1.0Thumb
1.0PGP(18:1(11Z)/16:0) + 1.0Water → 1.0PG(18:1(11Z)/16:0) + 1.0Phosphate
ReactionCard
1.0Thumb+1.0Thumb1.0Thumb+1.0PG(18:0/18:0)+1.0Thumb
1.0PGP(18:0/18:0) + 1.0Water → 1.0Phosphate + 1.0PG(18:0/18:0) + 1.0PG(18:0/18:0)
ReactionCard
1.0Thumb+1.0Thumb1.0Thumb+1.0Thumb
1.0Thumb+1.0Thumb1.0Thumb+1.0Thumb
1.0Thumb+1.0Thumb1.0Thumb+1.0Thumb
1.0Thumb+1.0Thumb1.0Thumb+1.0Thumb
1.0Thumb+1.0Thumb1.0Thumb+1.0Thumb
1.0Thumb+1.0Thumb1.0Thumb+1.0Thumb
1.0Thumb+1.0Thumb+1.0Thumb1.0Thumb+1.0Thumb
1.0Thumb+1.0Thumb1.0Thumb+1.0Thumb
1.0Thumb+1.0Thumb+1.0Thumb1.0Thumb+1.0Thumb
1.0Thumb+1.0Thumb1.0Thumb+1.0Thumb
1.0Thumb+1.0Thumb1.0Thumb+1.0Thumb
1.0Thumb+1.0Thumb1.0Thumb+1.0Thumb
1.0Thumb+1.0Thumb1.0Thumb+1.0Thumb
1.0Thumb+1.0Thumb1.0Thumb+1.0Thumb
1.0Thumb+1.0Thumb+1.0Thumb1.0Thumb+1.0Thumb
1.0Thumb+1.0Thumb1.0Thumb+1.0Thumb
1.0Thumb+1.0Thumb1.0Thumb+1.0Thumb
1.0Thumb+1.0Thumb1.0Thumb+1.0Thumb
1.0Thumb+1.0Thumb1.0Thumb+1.0Thumb
1.0Thumb+1.0Thumb1.0Thumb+1.0Thumb
1.0Thumb+1.0Thumb1.0Thumb+1.0Thumb
1.0Thumb+1.0Thumb1.0Thumb+1.0Thumb
1.0Thumb+1.0Thumb1.0Thumb+1.0Thumb
1.0Thumb+1.0Thumb1.0Thumb+1.0Thumb
1.0Thumb+1.0Thumb1.0Thumb+1.0Thumb
1.0Thumb+1.0Thumb1.0Thumb+1.0Thumb
1.0Thumb+1.0Thumb1.0Thumb+1.0Thumb
1.0Thumb+1.0Thumb1.0Thumb+1.0Thumb
1.0Thumb+1.0Thumb1.0Thumb+1.0Thumb
1.0Thumb+1.0Thumb1.0Thumb+1.0Thumb
1.0Thumb+1.0Thumb ? 1.0Thumb+1.0Thumb
1.0Thumb+1.0Thumb1.0Thumb+1.0Thumb
1.0Thumb+1.0Thumb1.0Thumb+1.0Thumb
1.0Thumb+1.0Thumb1.0Thumb+1.0Thumb
1.0Thumb+1.0Thumb1.0Thumb+1.0Thumb
1.0Thumb+1.0Thumb1.0Thumb+1.0Thumb
1.0Thumb+1.0Thumb1.0Thumb+1.0Thumb
1.0Thumb+1.0Thumb1.0Thumb+1.0Thumb
2.0Thumb+1.0Thumb2.0Thumb+1.0Thumb
2.0Thumb+1.0Thumb2.0Thumb+1.0Thumb
2.0Thumb+1.0Thumb2.0Thumb+1.0Thumb
2.0Thumb+1.0Thumb2.0Thumb+1.0Thumb
2.0Thumb+1.0Thumb2.0Thumb+1.0Thumb
2.0Thumb+1.0Thumb2.0Thumb+1.0Thumb
2.0Thumb+1.0Thumb2.0Thumb+1.0Thumb
2.0Thumb+1.0Thumb2.0Thumb+1.0Thumb
2.0Thumb+1.0Thumb2.0Thumb+1.0Thumb
2.0Thumb+1.0Thumb2.0Thumb+1.0Thumb
2.0Thumb+1.0Thumb2.0Thumb+1.0Thumb
2.0Thumb+1.0Thumb1.0Thumb+1.0Thumb
2.0Thumb+1.0Thumb2.0Thumb+1.0Thumb
2.0Thumb+1.0Thumb2.0Thumb+1.0Thumb
2.0Thumb+1.0Thumb2.0Thumb+1.0Thumb
2.0Thumb+1.0Thumb2.0Thumb+1.0Thumb
2.0Thumb+1.0Thumb2.0Thumb+1.0Thumb
2.0Thumb+1.0Thumb2.0Thumb+1.0Thumb
2.0Thumb+1.0Thumb2.0Thumb+1.0Thumb
2.0Thumb+1.0Thumb2.0Thumb+1.0Thumb
2.0Thumb+1.0Thumb2.0Thumb+1.0Thumb
2.0Thumb+1.0Thumb2.0Thumb+1.0Thumb
2.0Thumb+1.0Thumb2.0Thumb+1.0Thumb
2.0Thumb+1.0Thumb2.0Thumb+1.0Thumb
2.0Thumb+1.0Thumb2.0Thumb+1.0Thumb
2.0Thumb+1.0Thumb2.0Thumb+1.0Thumb
2.0Thumb+1.0Thumb2.0Thumb+1.0Thumb
2.0Thumb+1.0Thumb2.0Thumb+1.0Thumb
2.0Thumb+1.0Thumb2.0Thumb+1.0Thumb
2.0Thumb+1.0Thumb2.0Thumb+1.0Thumb
2.0Thumb+1.0Thumb2.0Thumb+1.0Thumb
2.0Thumb+1.0Thumb2.0Thumb+1.0Thumb
2.0Thumb+1.0Thumb2.0Thumb+1.0Thumb
2.0Thumb+1.0Thumb2.0Thumb+1.0Thumb
2.0Thumb+1.0Thumb2.0Thumb+1.0Thumb
2.0Thumb+1.0Thumb2.0Thumb+1.0Thumb
2.0Thumb+1.0Thumb2.0Thumb+1.0Thumb
2.0Thumb+1.0Thumb2.0Thumb+1.0Thumb
2.0Thumb+1.0Thumb2.0Thumb+1.0Thumb
2.0Thumb+1.0Thumb2.0Thumb+1.0Thumb
2.0Thumb+1.0Thumb2.0Thumb+1.0Thumb
2.0Thumb+1.0Thumb2.0Thumb+1.0Thumb
2.0Thumb+1.0Thumb2.0Thumb+1.0Thumb
2.0Thumb+1.0Thumb2.0Thumb+1.0Thumb
2.0Thumb+1.0Thumb2.0Thumb+1.0Thumb
2.0Thumb+1.0Thumb2.0Thumb+1.0Thumb
2.0Thumb+1.0Thumb2.0Thumb+1.0Thumb
2.0Thumb+1.0Thumb2.0Thumb+1.0Thumb
2.0Thumb+1.0Thumb2.0Thumb+1.0Thumb
2.0Thumb+1.0Thumb2.0Thumb+1.0Thumb
2.0Thumb+1.0Thumb2.0Thumb+1.0Thumb
2.0Thumb+1.0Thumb2.0Thumb+1.0Thumb
2.0Thumb+1.0Thumb2.0Thumb+1.0Thumb
2.0Thumb+1.0Thumb2.0PG(19:iso/14:0(3-OH))+1.0Thumb
2.0PGP(19:iso/14:0(3-OH)) + 1.0Water → 2.0PG(19:iso/14:0(3-OH)) + 1.0Phosphate
ReactionCard
2.0Thumb+1.0Thumb2.0Thumb+1.0Thumb
2.0Thumb+1.0Thumb2.0Thumb+1.0Thumb
2.0Thumb+1.0Thumb2.0Thumb+1.0Thumb
2.0Thumb+1.0Thumb2.0Thumb+1.0Thumb
2.0Thumb+1.0Thumb2.0Thumb+1.0Thumb
2.0Thumb+1.0Thumb2.0Thumb+1.0Thumb
2.0Thumb+1.0Thumb2.0Thumb+1.0Thumb
2.0Thumb+1.0Thumb2.0Thumb+1.0Thumb
2.0Thumb+1.0Thumb2.0Thumb+1.0Thumb
1.0Thumb+1.0Thumb1.0Thumb+1.0Thumb
2.0Thumb+1.0Thumb2.0Thumb+1.0Thumb
2.0Thumb+1.0Thumb2.0Thumb+1.0Thumb
2.0Thumb+1.0Thumb2.0Thumb+1.0Thumb
2.0Thumb+1.0Thumb2.0Thumb+1.0Thumb
2.0Thumb+1.0Thumb2.0Thumb+1.0Thumb
2.0Thumb+1.0Thumb2.0Thumb+1.0Thumb
2.0Thumb+1.0Thumb2.0Thumb+1.0Thumb
2.0Thumb+1.0Thumb2.0Thumb+1.0Thumb
2.0Thumb+1.0Thumb2.0Thumb+1.0Thumb
2.0Thumb+1.0Thumb2.0Thumb+1.0Thumb
2.0Thumb+1.0Thumb2.0Thumb+1.0Thumb
2.0Thumb+1.0Thumb2.0Thumb+1.0Thumb
2.0Thumb+1.0Thumb2.0Thumb+1.0Thumb
2.0Thumb+1.0Thumb2.0Thumb+1.0Thumb
2.0Thumb+1.0Thumb2.0Thumb+1.0Thumb
2.0Thumb+1.0Thumb2.0Thumb+1.0Thumb
2.0Thumb+1.0Thumb2.0Thumb+1.0Thumb
2.0Thumb+1.0Thumb2.0Thumb+1.0Thumb
2.0Thumb+1.0Thumb2.0Thumb+1.0Thumb
2.0Thumb+1.0Thumb2.0Thumb+1.0Thumb
2.0Thumb+1.0Thumb2.0Thumb+1.0Thumb
2.0Thumb+1.0Thumb2.0Thumb+1.0Thumb
2.0Thumb+1.0Thumb2.0Thumb+1.0Thumb
2.0Thumb+1.0Thumb2.0Thumb+1.0Thumb
2.0Thumb+1.0Thumb2.0Thumb+1.0Thumb
2.0Thumb+1.0Thumb2.0Thumb+1.0Thumb
2.0Thumb+1.0Thumb2.0Thumb+1.0Thumb
2.0Thumb+1.0Thumb2.0Thumb+1.0Thumb
2.0Thumb+1.0Thumb2.0Thumb+1.0Thumb
2.0Thumb+1.0Thumb2.0Thumb+1.0Thumb
2.0Thumb+1.0Thumb2.0Thumb+1.0Thumb
2.0Thumb+1.0Thumb2.0Thumb+1.0Thumb
2.0Thumb+1.0Thumb2.0Thumb+1.0Thumb
2.0Thumb+1.0Thumb2.0Thumb+1.0Thumb
2.0Thumb+1.0Thumb2.0Thumb+1.0Thumb
2.0Thumb+1.0Thumb2.0Thumb+1.0Thumb
2.0Thumb+1.0Thumb2.0Thumb+1.0Thumb
2.0Thumb+1.0Thumb2.0Thumb+1.0Thumb
2.0Thumb+1.0Thumb2.0Thumb+1.0Thumb
2.0Thumb+1.0Thumb2.0Thumb+1.0Thumb
2.0Thumb+1.0Thumb2.0Thumb+1.0Thumb
2.0Thumb+1.0Thumb2.0Thumb+1.0Thumb
2.0Thumb+1.0Thumb2.0Thumb+1.0Thumb
2.0Thumb+1.0Thumb2.0Thumb+1.0Thumb
2.0Thumb+1.0Thumb2.0Thumb+1.0Thumb
2.0Thumb+1.0Thumb2.0Thumb+1.0Thumb
2.0Thumb+1.0Thumb2.0Thumb+1.0Thumb
2.0Thumb+1.0Thumb2.0Thumb+1.0Thumb
2.0Thumb+1.0Thumb2.0Thumb+1.0Thumb
2.0Thumb+1.0Thumb2.0Thumb+1.0Thumb
2.0Thumb+1.0Thumb2.0Thumb+1.0Thumb
2.0Thumb+1.0Thumb2.0Thumb+1.0Thumb
2.0Thumb+1.0Thumb2.0Thumb+1.0Thumb
2.0Thumb+1.0Thumb2.0Thumb+1.0Thumb
2.0Thumb+1.0Thumb2.0Thumb+1.0Thumb
2.0Thumb+1.0Thumb2.0Thumb+1.0Thumb
2.0Thumb+1.0Thumb2.0Thumb+1.0Thumb
2.0Thumb+1.0Thumb2.0Thumb+1.0Thumb
2.0Thumb+1.0Thumb2.0Thumb+1.0Thumb
2.0Thumb+1.0Thumb2.0Thumb+1.0Thumb
2.0Thumb+1.0Thumb2.0Thumb+1.0Thumb
2.0Thumb+1.0Thumb2.0Thumb+1.0Thumb
2.0Thumb+1.0Thumb2.0Thumb+1.0Thumb
2.0Thumb+1.0Thumb2.0Thumb+1.0Thumb
2.0Thumb+1.0Thumb2.0Thumb+1.0Thumb
2.0Thumb+1.0Thumb2.0Thumb+1.0Thumb
2.0Thumb+1.0Thumb2.0Thumb+1.0Thumb
2.0Thumb+1.0Thumb2.0Thumb+1.0Thumb
2.0Thumb+1.0Thumb2.0Thumb+1.0Thumb
2.0Thumb+1.0Thumb2.0Thumb+1.0Thumb
2.0Thumb+1.0Thumb2.0Thumb+1.0Thumb
2.0Thumb+1.0Thumb2.0Thumb+1.0Thumb
2.0Thumb+1.0Thumb2.0Thumb+1.0Thumb
2.0Thumb+1.0Thumb2.0Thumb+1.0Thumb
2.0Thumb+1.0Thumb2.0Thumb+1.0Thumb
2.0Thumb+1.0Thumb2.0Thumb+1.0Thumb
2.0Thumb+1.0Thumb2.0Thumb+1.0Thumb
2.0Thumb+1.0Thumb2.0Thumb+1.0Thumb
2.0Thumb+1.0Thumb2.0Thumb+1.0Thumb
2.0Thumb+1.0Thumb2.0Thumb+1.0Thumb
2.0Thumb+1.0Thumb2.0Thumb+1.0Thumb
2.0Thumb+1.0Thumb2.0Thumb+1.0Thumb
2.0Thumb+1.0Thumb2.0Thumb+1.0Thumb
2.0Thumb+1.0Thumb2.0Thumb+1.0Thumb
2.0Thumb+1.0Thumb2.0Thumb+1.0Thumb
2.0Thumb+1.0Thumb2.0Thumb+1.0Thumb
2.0Thumb+1.0Thumb2.0Thumb+1.0Thumb
2.0Thumb+1.0Thumb2.0Thumb+1.0Thumb
2.0Thumb+1.0Thumb2.0Thumb+1.0Thumb
2.0Thumb+1.0Thumb2.0Thumb+1.0Thumb
2.0Thumb+1.0Thumb2.0Thumb+1.0Thumb
2.0Thumb+1.0Thumb2.0Thumb+1.0Thumb
2.0Thumb+1.0Thumb2.0Thumb+1.0Thumb
2.0Thumb+1.0Thumb2.0Thumb+1.0Thumb
2.0Thumb+1.0Thumb2.0Thumb+1.0Thumb
EcoCyc Reactions:
1.0an L-1-phosphatidylglycerol-phosphate+1.0Thumb1.0an L-1-phosphatidyl-glycerol+1.0Thumb
1.0an L-1-phosphatidylglycerol-phosphate + 1.0Water ↔ 1.0an L-1-phosphatidyl-glycerol + 1.0Phosphate
ReactionCard
Complex Reactions:
1.0Thumb+1.0Thumb1.0Thumb+1.0Thumb
1.0Thumb+1.0Thumb1.0Thumb+1.0Thumb
1.0Thumb+1.0Thumb1.0Thumb+1.0Thumb
1.0Thumb+1.0Thumb1.0Thumb+1.0Thumb
1.0Thumb+1.0Thumb1.0Thumb+1.0Thumb
1.0Thumb+1.0Thumb1.0Thumb+1.0Thumb
1.0Thumb+1.0Thumb1.0Thumb+1.0Thumb
1.0Thumb+1.0Thumb1.0phosphatidylglycerol+1.0Thumb
1.0Phosphatidylglycerophosphate + 1.0Water → 1.0phosphatidylglycerol + 1.0Inorganic phosphate
ReactionCard
Metabolites:
ECMDB IDNameView
ECMDB04030Carbon dioxideMetaboCard
ECMDB21225Hydrogen ionMetaboCard
ECMDB21380Inorganic phosphateMetaboCard
ECMDB24116PE(16:1(9Z)/18:1(9Z))MetaboCard
ECMDB24564PE(17:0cycw7c/14:0)MetaboCard
ECMDB23632PG(10:0(3-OH)/10:0(3-OH))MetaboCard
ECMDB23631PG(10:0(3-OH)/10:0)MetaboCard
ECMDB23634PG(10:0(3-OH)/12:0(3-OH))MetaboCard
ECMDB23633PG(10:0(3-OH)/12:0)MetaboCard
ECMDB23636PG(10:0(3-OH)/14:0(3-OH))MetaboCard
ECMDB23635PG(10:0(3-OH)/14:0)MetaboCard
ECMDB23637PG(10:0(3-OH)/15:0)MetaboCard
ECMDB23638PG(10:0(3-OH)/15:0cyclo)MetaboCard
ECMDB23639PG(10:0(3-OH)/16:0)MetaboCard
ECMDB23640PG(10:0(3-OH)/16:1(9Z))MetaboCard
ECMDB23641PG(10:0(3-OH)/17:0cycw7c)MetaboCard
ECMDB23642PG(10:0(3-OH)/18:1(9Z))MetaboCard
ECMDB23643PG(10:0(3-OH)/19:0cycv8c)MetaboCard
ECMDB23644PG(10:0(3-OH)/19:iso)MetaboCard
ECMDB23645PG(10:0/10:0(3-OH))MetaboCard
ECMDB24262PG(10:0/10:0)MetaboCard
ECMDB23646PG(10:0/12:0(3-OH))MetaboCard
ECMDB23647PG(10:0/14:0(3-OH))MetaboCard
ECMDB23648PG(10:0/19:iso)MetaboCard
ECMDB23650PG(12:0(3-OH)/10:0(3-OH))MetaboCard
ECMDB23649PG(12:0(3-OH)/10:0)MetaboCard
ECMDB23652PG(12:0(3-OH)/12:0(3-OH))MetaboCard
ECMDB23651PG(12:0(3-OH)/12:0)MetaboCard
ECMDB23654PG(12:0(3-OH)/14:0(3-OH))MetaboCard
ECMDB23653PG(12:0(3-OH)/14:0)MetaboCard
ECMDB23655PG(12:0(3-OH)/15:0)MetaboCard
ECMDB23656PG(12:0(3-OH)/15:0cyclo)MetaboCard
ECMDB23657PG(12:0(3-OH)/16:0)MetaboCard
ECMDB23658PG(12:0(3-OH)/16:1(9Z))MetaboCard
ECMDB23659PG(12:0(3-OH)/17:0cycw7c)MetaboCard
ECMDB23660PG(12:0(3-OH)/18:1(9Z))MetaboCard
ECMDB23661PG(12:0(3-OH)/19:0cycv8c)MetaboCard
ECMDB23662PG(12:0(3-OH)/19:iso)MetaboCard
ECMDB23663PG(12:0/10:0(3-OH))MetaboCard
ECMDB23664PG(12:0/12:0(3-OH))MetaboCard
ECMDB21265PG(12:0/12:0)MetaboCard
ECMDB23665PG(12:0/14:0(3-OH))MetaboCard
ECMDB23666PG(12:0/19:iso)MetaboCard
ECMDB23668PG(14:0(3-OH)/10:0(3-OH))MetaboCard
ECMDB23667PG(14:0(3-OH)/10:0)MetaboCard
ECMDB23670PG(14:0(3-OH)/12:0(3-OH))MetaboCard
ECMDB23669PG(14:0(3-OH)/12:0)MetaboCard
ECMDB23672PG(14:0(3-OH)/14:0(3-OH))MetaboCard
ECMDB23671PG(14:0(3-OH)/14:0)MetaboCard
ECMDB23673PG(14:0(3-OH)/15:0)MetaboCard
ECMDB23674PG(14:0(3-OH)/15:0cyclo)MetaboCard
ECMDB23675PG(14:0(3-OH)/16:0)MetaboCard
ECMDB23676PG(14:0(3-OH)/16:1(9Z))MetaboCard
ECMDB23677PG(14:0(3-OH)/17:0cycw7c)MetaboCard
ECMDB23678PG(14:0(3-OH)/18:1(9Z))MetaboCard
ECMDB23679PG(14:0(3-OH)/19:0cycv8c)MetaboCard
ECMDB23680PG(14:0(3-OH)/19:iso)MetaboCard
ECMDB23681PG(14:0/10:0(3-OH))MetaboCard
ECMDB23682PG(14:0/12:0(3-OH))MetaboCard
ECMDB23683PG(14:0/14:0(3-OH))MetaboCard
ECMDB21013PG(14:0/14:0)MetaboCard
ECMDB24377PG(14:0/15:0cyclo)MetaboCard
ECMDB21021PG(14:0/16:0)MetaboCard
ECMDB21052PG(14:0/16:1(9Z))MetaboCard
ECMDB21029PG(14:0/17:0)MetaboCard
ECMDB21635PG(14:0/17:0cycw7c)MetaboCard
ECMDB21048PG(14:0/18:1(11Z))MetaboCard
ECMDB24263PG(14:0/18:1(9Z))MetaboCard
ECMDB21041PG(14:0/19:0)MetaboCard
ECMDB24378PG(14:0/19:0cycv8c)MetaboCard
ECMDB23684PG(14:0/19:iso)MetaboCard
ECMDB21266PG(14:1(7Z)/14:1(7Z))MetaboCard
ECMDB23685PG(15:0/10:0(3-OH))MetaboCard
ECMDB23686PG(15:0/12:0(3-OH))MetaboCard
ECMDB23687PG(15:0/14:0(3-OH))MetaboCard
ECMDB21636PG(15:0/16:1)MetaboCard
ECMDB21637PG(15:0/17:0cycw7c)MetaboCard
ECMDB23688PG(15:0/19:iso)MetaboCard
ECMDB23689PG(15:0cyclo/10:0(3-OH))MetaboCard
ECMDB23690PG(15:0cyclo/12:0(3-OH))MetaboCard
ECMDB23691PG(15:0cyclo/14:0(3-OH))MetaboCard
ECMDB24379PG(15:0cyclo/14:0)MetaboCard
ECMDB24380PG(15:0cyclo/15:0cyclo)MetaboCard
ECMDB24381PG(15:0cyclo/16:0)MetaboCard
ECMDB24382PG(15:0cyclo/17:0cycw7c)MetaboCard
ECMDB24383PG(15:0cyclo/19:0cycv8c)MetaboCard
ECMDB23692PG(15:0cyclo/19:iso)MetaboCard
ECMDB23693PG(16:0/10:0(3-OH))MetaboCard
ECMDB23694PG(16:0/12:0(3-OH))MetaboCard
ECMDB23695PG(16:0/14:0(3-OH))MetaboCard
ECMDB21063PG(16:0/14:0)MetaboCard
ECMDB24264PG(16:0/15:0)MetaboCard
ECMDB10570PG(16:0/16:0)MetaboCard
ECMDB10571PG(16:0/16:1(9Z))MetaboCard
ECMDB21074PG(16:0/17:0)MetaboCard
ECMDB21638PG(16:0/17:0cycw7c)MetaboCard
ECMDB21453PG(16:0/18:0)MetaboCard
ECMDB10573PG(16:0/18:1(11Z))MetaboCard
ECMDB24132PG(16:0/18:1(9Z))MetaboCard
ECMDB21084PG(16:0/19:0)MetaboCard
ECMDB21639PG(16:0/19:0cycw8c)MetaboCard
ECMDB24384PG(16:0/19:1(9Z))MetaboCard
ECMDB23696PG(16:0/19:iso)MetaboCard
ECMDB23697PG(16:1(9Z)/10:0(3-OH))MetaboCard
ECMDB23698PG(16:1(9Z)/12:0(3-OH))MetaboCard
ECMDB24266PG(16:1(9Z)/12:0)MetaboCard
ECMDB23699PG(16:1(9Z)/14:0(3-OH))MetaboCard
ECMDB21035PG(16:1(9Z)/14:0)MetaboCard
ECMDB24267PG(16:1(9Z)/15:0)MetaboCard
ECMDB10585PG(16:1(9Z)/16:0)MetaboCard
ECMDB10586PG(16:1(9Z)/16:1(9Z))MetaboCard
ECMDB21073PG(16:1(9Z)/17:0)MetaboCard
ECMDB24385PG(16:1(9Z)/17:0cycw7c)MetaboCard
ECMDB10588PG(16:1(9Z)/18:1(11Z))MetaboCard
ECMDB24133PG(16:1(9Z)/18:1(9Z))MetaboCard
ECMDB21075PG(16:1(9Z)/19:0)MetaboCard
ECMDB24386PG(16:1(9Z)/19:0cycv8c)MetaboCard
ECMDB23700PG(16:1(9Z)/19:iso)MetaboCard
ECMDB21086PG(17:0/14:0)MetaboCard
ECMDB21049PG(17:0/16:0)MetaboCard
ECMDB21070PG(17:0/16:1(9Z))MetaboCard
ECMDB21022PG(17:0/17:0)MetaboCard
ECMDB21069PG(17:0/18:1(11Z))MetaboCard
ECMDB21087PG(17:0/19:0)MetaboCard
ECMDB23701PG(17:0cycw7c/10:0(3-OH))MetaboCard
ECMDB23702PG(17:0cycw7c/12:0(3-OH))MetaboCard
ECMDB23703PG(17:0cycw7c/14:0(3-OH))MetaboCard
ECMDB24387PG(17:0cycw7c/14:0)MetaboCard
ECMDB24388PG(17:0cycw7c/16:0)MetaboCard
ECMDB24389PG(17:0cycw7c/16:1(9Z))MetaboCard
ECMDB24390PG(17:0cycw7c/17:0cycw7c)MetaboCard
ECMDB24391PG(17:0cycw7c/18:1(9Z))MetaboCard
ECMDB24392PG(17:0cycw7c/19:0cycv8c)MetaboCard
ECMDB23704PG(17:0cycw7c/19:iso)MetaboCard
ECMDB24268PG(18:0/12:0)MetaboCard
ECMDB21267PG(18:0/18:0)MetaboCard
ECMDB24273PG(18:0/18:1(9Z))MetaboCard
ECMDB21085PG(18:1(11Z)/14:0)MetaboCard
ECMDB10615PG(18:1(11Z)/16:0)MetaboCard
ECMDB10616PG(18:1(11Z)/16:1(9Z))MetaboCard
ECMDB21067PG(18:1(11Z)/17:0)MetaboCard
ECMDB10618PG(18:1(11Z)/18:1(11Z))MetaboCard
ECMDB24275PG(18:1(11Z)/18:1(9Z))MetaboCard
ECMDB21068PG(18:1(11Z)/19:0)MetaboCard
ECMDB23705PG(18:1(9Z)/10:0(3-OH))MetaboCard
ECMDB23706PG(18:1(9Z)/12:0(3-OH))MetaboCard
ECMDB24276PG(18:1(9Z)/12:0)MetaboCard
ECMDB23707PG(18:1(9Z)/14:0(3-OH))MetaboCard
ECMDB24277PG(18:1(9Z)/14:0)MetaboCard
ECMDB24278PG(18:1(9Z)/15:0)MetaboCard
ECMDB24394PG(18:1(9Z)/15:0cyclo)MetaboCard
ECMDB24134PG(18:1(9Z)/16:0)MetaboCard
ECMDB24135PG(18:1(9Z)/16:1(9Z))MetaboCard
ECMDB24395PG(18:1(9Z)/17:0cycw7c)MetaboCard
ECMDB24280PG(18:1(9Z)/18:1(11Z))MetaboCard
ECMDB24136PG(18:1(9Z)/18:1(9Z))MetaboCard
ECMDB24396PG(18:1(9Z)/19:0cycv8c)MetaboCard
ECMDB23708PG(18:1(9Z)/19:iso)MetaboCard
ECMDB24137PG(18:2(9Z,12Z)/18:2(9Z,12Z))MetaboCard
ECMDB21030PG(19:0/14:0)MetaboCard
ECMDB21032PG(19:0/16:0)MetaboCard
ECMDB21072PG(19:0/16:1(9Z))MetaboCard
ECMDB21033PG(19:0/17:0)MetaboCard
ECMDB21071PG(19:0/18:1(11Z))MetaboCard
ECMDB21034PG(19:0/19:0)MetaboCard
ECMDB23709PG(19:0cycv8c/10:0(3-OH))MetaboCard
ECMDB23710PG(19:0cycv8c/12:0(3-OH))MetaboCard
ECMDB23711PG(19:0cycv8c/14:0(3-OH))MetaboCard
ECMDB24398PG(19:0cycv8c/14:0)MetaboCard
ECMDB24399PG(19:0cycv8c/15:0cyclo)MetaboCard
ECMDB24400PG(19:0cycv8c/16:0)MetaboCard
ECMDB24401PG(19:0cycv8c/16:1(9Z))MetaboCard
ECMDB24402PG(19:0cycv8c/17:0cycw7c)MetaboCard
ECMDB24403PG(19:0cycv8c/18:1(9Z))MetaboCard
ECMDB24404PG(19:0cycv8c/19:0cycv8c)MetaboCard
ECMDB23712PG(19:0cycv8c/19:iso)MetaboCard
ECMDB24408PG(19:1(9Z)/16:0)MetaboCard
ECMDB24409PG(19:1(9Z)/16:1(9Z))MetaboCard
ECMDB23714PG(19:iso/10:0(3-OH))MetaboCard
ECMDB23713PG(19:iso/10:0)MetaboCard
ECMDB23716PG(19:iso/12:0(3-OH))MetaboCard
ECMDB23715PG(19:iso/12:0)MetaboCard
ECMDB23718PG(19:iso/14:0(3-OH))MetaboCard
ECMDB23717PG(19:iso/14:0)MetaboCard
ECMDB23719PG(19:iso/15:0)MetaboCard
ECMDB23720PG(19:iso/15:0cyclo)MetaboCard
ECMDB23721PG(19:iso/16:0)MetaboCard
ECMDB23722PG(19:iso/16:1(9Z))MetaboCard
ECMDB23723PG(19:iso/17:0cycw7c)MetaboCard
ECMDB23724PG(19:iso/18:1(9Z))MetaboCard
ECMDB23725PG(19:iso/19:0cycv8c)MetaboCard
ECMDB23726PG(19:iso/19:iso)MetaboCard
ECMDB24411PGP(10:0(3-OH)/10:0(3-OH))MetaboCard
ECMDB24412PGP(10:0(3-OH)/10:0)MetaboCard
ECMDB24413PGP(10:0(3-OH)/12:0(3-OH))MetaboCard
ECMDB24414PGP(10:0(3-OH)/12:0)MetaboCard
ECMDB24415PGP(10:0(3-OH)/14:0(3-OH))MetaboCard
ECMDB24416PGP(10:0(3-OH)/14:0)MetaboCard
ECMDB24417PGP(10:0(3-OH)/15:0)MetaboCard
ECMDB24418PGP(10:0(3-OH)/15:0cyclo)MetaboCard
ECMDB24419PGP(10:0(3-OH)/16:0)MetaboCard
ECMDB24420PGP(10:0(3-OH)/16:1(9Z))MetaboCard
ECMDB24421PGP(10:0(3-OH)/17:0cycw7c)MetaboCard
ECMDB24422PGP(10:0(3-OH)/18:1(9Z))MetaboCard
ECMDB24423PGP(10:0(3-OH)/19:0cycv8c)MetaboCard
ECMDB24424PGP(10:0(3-OH)/19:iso)MetaboCard
ECMDB24425PGP(10:0/10:0(3-OH))MetaboCard
ECMDB24281PGP(10:0/10:0)MetaboCard
ECMDB24426PGP(10:0/12:0(3-OH))MetaboCard
ECMDB24427PGP(10:0/14:0(3-OH))MetaboCard
ECMDB24428PGP(10:0/19:iso)MetaboCard
ECMDB24429PGP(12:0(3-OH)/10:0(3-OH))MetaboCard
ECMDB24430PGP(12:0(3-OH)/10:0)MetaboCard
ECMDB24431PGP(12:0(3-OH)/12:0(3-OH))MetaboCard
ECMDB24432PGP(12:0(3-OH)/12:0)MetaboCard
ECMDB24433PGP(12:0(3-OH)/14:0(3-OH))MetaboCard
ECMDB24434PGP(12:0(3-OH)/14:0)MetaboCard
ECMDB24435PGP(12:0(3-OH)/15:0)MetaboCard
ECMDB24436PGP(12:0(3-OH)/15:0cyclo)MetaboCard
ECMDB24437PGP(12:0(3-OH)/16:0)MetaboCard
ECMDB24438PGP(12:0(3-OH)/16:1(9Z))MetaboCard
ECMDB24439PGP(12:0(3-OH)/17:0cycw7c)MetaboCard
ECMDB24440PGP(12:0(3-OH)/18:1(9Z))MetaboCard
ECMDB24441PGP(12:0(3-OH)/19:0cycv8c)MetaboCard
ECMDB24442PGP(12:0(3-OH)/19:iso)MetaboCard
ECMDB24443PGP(12:0/10:0(3-OH))MetaboCard
ECMDB24444PGP(12:0/12:0(3-OH))MetaboCard
ECMDB21268PGP(12:0/12:0)MetaboCard
ECMDB24445PGP(12:0/14:0(3-OH))MetaboCard
ECMDB24446PGP(12:0/19:iso)MetaboCard
ECMDB24447PGP(14:0(3-OH)/10:0(3-OH))MetaboCard
ECMDB24448PGP(14:0(3-OH)/10:0)MetaboCard
ECMDB24449PGP(14:0(3-OH)/12:0(3-OH))MetaboCard
ECMDB24450PGP(14:0(3-OH)/12:0)MetaboCard
ECMDB24451PGP(14:0(3-OH)/14:0(3-OH))MetaboCard
ECMDB24452PGP(14:0(3-OH)/14:0)MetaboCard
ECMDB24453PGP(14:0(3-OH)/15:0)MetaboCard
ECMDB24454PGP(14:0(3-OH)/15:0cyclo)MetaboCard
ECMDB24455PGP(14:0(3-OH)/16:0)MetaboCard
ECMDB24456PGP(14:0(3-OH)/16:1(9Z))MetaboCard
ECMDB24457PGP(14:0(3-OH)/17:0cycw7c)MetaboCard
ECMDB24458PGP(14:0(3-OH)/18:1(9Z))MetaboCard
ECMDB24459PGP(14:0(3-OH)/19:0cycv8c)MetaboCard
ECMDB24460PGP(14:0(3-OH)/19:iso)MetaboCard
ECMDB24461PGP(14:0/10:0(3-OH))MetaboCard
ECMDB24462PGP(14:0/12:0(3-OH))MetaboCard
ECMDB24463PGP(14:0/14:0(3-OH))MetaboCard
ECMDB21269PGP(14:0/14:0)MetaboCard
ECMDB24464PGP(14:0/15:0cyclo)MetaboCard
ECMDB24282PGP(14:0/16:0)MetaboCard
ECMDB24283PGP(14:0/16:1(9Z))MetaboCard
ECMDB24284PGP(14:0/17:0)MetaboCard
ECMDB24465PGP(14:0/17:0cycw7c)MetaboCard
ECMDB24285PGP(14:0/18:1(11Z))MetaboCard
ECMDB24286PGP(14:0/18:1(9Z))MetaboCard
ECMDB24287PGP(14:0/19:0)MetaboCard
ECMDB24466PGP(14:0/19:0cycv8c)MetaboCard
ECMDB24467PGP(14:0/19:iso)MetaboCard
ECMDB21270PGP(14:1(7Z)/14:1(7Z))MetaboCard
ECMDB24468PGP(15:0/10:0(3-OH))MetaboCard
ECMDB24469PGP(15:0/12:0(3-OH))MetaboCard
ECMDB24471PGP(15:0/17:0cycw7c)MetaboCard
ECMDB24472PGP(15:0/19:iso)MetaboCard
ECMDB24473PGP(15:0cyclo/10:0(3-OH))MetaboCard
ECMDB24474PGP(15:0cyclo/12:0(3-OH))MetaboCard
ECMDB24475PGP(15:0cyclo/14:0(3-OH))MetaboCard
ECMDB24476PGP(15:0cyclo/14:0)MetaboCard
ECMDB24477PGP(15:0cyclo/15:0cyclo)MetaboCard
ECMDB24478PGP(15:0cyclo/16:0)MetaboCard
ECMDB24479PGP(15:0cyclo/17:0cycw7c)MetaboCard
ECMDB24480PGP(15:0cyclo/19:0cycv8c)MetaboCard
ECMDB24481PGP(15:0cyclo/19:iso)MetaboCard
ECMDB24482PGP(16:0/10:0(3-OH))MetaboCard
ECMDB24483PGP(16:0/12:0(3-OH))MetaboCard
ECMDB24484PGP(16:0/14:0(3-OH))MetaboCard
ECMDB24288PGP(16:0/14:0)MetaboCard
ECMDB24289PGP(16:0/15:0)MetaboCard
ECMDB21271PGP(16:0/16:0)MetaboCard
ECMDB24159PGP(16:0/16:1(9Z))MetaboCard
ECMDB24290PGP(16:0/17:0)MetaboCard
ECMDB24485PGP(16:0/17:0cycw7c)MetaboCard
ECMDB24160PGP(16:0/18:0)MetaboCard
ECMDB24161PGP(16:0/18:1(11Z))MetaboCard
ECMDB24162PGP(16:0/18:1(9Z))MetaboCard
ECMDB24291PGP(16:0/19:0)MetaboCard
ECMDB24487PGP(16:0/19:0cycw8c)MetaboCard
ECMDB24488PGP(16:0/19:1(9Z))MetaboCard
ECMDB24489PGP(16:0/19:iso)MetaboCard
ECMDB24163PGP(16:0/22:5(7Z,10Z,13Z,16Z,19Z))MetaboCard
ECMDB24490PGP(16:1(9Z)/10:0(3-OH))MetaboCard
ECMDB24491PGP(16:1(9Z)/12:0(3-OH))MetaboCard
ECMDB24292PGP(16:1(9Z)/12:0)MetaboCard
ECMDB24492PGP(16:1(9Z)/14:0(3-OH))MetaboCard
ECMDB24293PGP(16:1(9Z)/14:0)MetaboCard
ECMDB24294PGP(16:1(9Z)/15:0)MetaboCard
ECMDB24164PGP(16:1(9Z)/16:0)MetaboCard
ECMDB21272PGP(16:1(9Z)/16:1(9Z))MetaboCard
ECMDB24295PGP(16:1(9Z)/17:0)MetaboCard
ECMDB24493PGP(16:1(9Z)/17:0cycw7c)MetaboCard
ECMDB24165PGP(16:1(9Z)/18:1(11Z))MetaboCard
ECMDB24166PGP(16:1(9Z)/18:1(9Z))MetaboCard
ECMDB24297PGP(16:1(9Z)/19:0)MetaboCard
ECMDB24494PGP(16:1(9Z)/19:0cycv8c)MetaboCard
ECMDB24495PGP(16:1(9Z)/19:iso)MetaboCard
ECMDB24298PGP(17:0/14:0)MetaboCard
ECMDB24299PGP(17:0/16:0)MetaboCard
ECMDB24300PGP(17:0/16:1(9Z))MetaboCard
ECMDB24301PGP(17:0/17:0)MetaboCard
ECMDB24302PGP(17:0/18:1(11Z))MetaboCard
ECMDB24303PGP(17:0/19:0)MetaboCard
ECMDB24496PGP(17:0cycw7c/10:0(3-OH))MetaboCard
ECMDB24497PGP(17:0cycw7c/12:0(3-OH))MetaboCard
ECMDB24498PGP(17:0cycw7c/14:0(3-OH))MetaboCard
ECMDB24499PGP(17:0cycw7c/14:0)MetaboCard
ECMDB24500PGP(17:0cycw7c/16:0)MetaboCard
ECMDB24501PGP(17:0cycw7c/16:1(9Z))MetaboCard
ECMDB24502PGP(17:0cycw7c/17:0cycw7c)MetaboCard
ECMDB24503PGP(17:0cycw7c/18:1(9Z))MetaboCard
ECMDB24504PGP(17:0cycw7c/19:0cycv8c)MetaboCard
ECMDB24505PGP(17:0cycw7c/19:iso)MetaboCard
ECMDB24304PGP(18:0/12:0)MetaboCard
ECMDB21273PGP(18:0/18:0)MetaboCard
ECMDB24308PGP(18:0/18:1(9Z))MetaboCard
ECMDB24309PGP(18:1(11Z)/14:0)MetaboCard
ECMDB24310PGP(18:1(11Z)/17:0)MetaboCard
ECMDB21274PGP(18:1(11Z)/18:1(11Z))MetaboCard
ECMDB24311PGP(18:1(11Z)/19:0)MetaboCard
ECMDB24507PGP(18:1(9Z)/10:0(3-OH))MetaboCard
ECMDB24508PGP(18:1(9Z)/12:0(3-OH))MetaboCard
ECMDB24312PGP(18:1(9Z)/12:0)MetaboCard
ECMDB24509PGP(18:1(9Z)/14:0(3-OH))MetaboCard
ECMDB24313PGP(18:1(9Z)/14:0)MetaboCard
ECMDB24314PGP(18:1(9Z)/15:0)MetaboCard
ECMDB24510PGP(18:1(9Z)/15:0cyclo)MetaboCard
ECMDB24167PGP(18:1(9Z)/16:0)MetaboCard
ECMDB24168PGP(18:1(9Z)/16:1(9Z))MetaboCard
ECMDB24511PGP(18:1(9Z)/17:0cycw7c)MetaboCard
ECMDB24169PGP(18:1(9Z)/18:1(9Z))MetaboCard
ECMDB24512PGP(18:1(9Z)/19:0cycv8c)MetaboCard
ECMDB24514PGP(18:1(9Z)/19:iso)MetaboCard
ECMDB24170PGP(18:2(9Z,12Z)/18:2(9Z,12Z))MetaboCard
ECMDB24315PGP(19:0/14:0)MetaboCard
ECMDB24316PGP(19:0/16:0)MetaboCard
ECMDB24317PGP(19:0/16:1(9Z))MetaboCard
ECMDB24318PGP(19:0/17:0)MetaboCard
ECMDB24319PGP(19:0/18:1(11Z))MetaboCard
ECMDB24320PGP(19:0/19:0)MetaboCard
ECMDB24515PGP(19:0cycv8c/10:0(3-OH))MetaboCard
ECMDB24516PGP(19:0cycv8c/12:0(3-OH))MetaboCard
ECMDB24517PGP(19:0cycv8c/14:0(3-OH))MetaboCard
ECMDB24518PGP(19:0cycv8c/14:0)MetaboCard
ECMDB24519PGP(19:0cycv8c/15:0cyclo)MetaboCard
ECMDB24520PGP(19:0cycv8c/16:0)MetaboCard
ECMDB24521PGP(19:0cycv8c/16:1(9Z))MetaboCard
ECMDB24522PGP(19:0cycv8c/17:0cycw7c)MetaboCard
ECMDB24523PGP(19:0cycv8c/18:1(9Z))MetaboCard
ECMDB24524PGP(19:0cycv8c/19:0cycv8c)MetaboCard
ECMDB24525PGP(19:0cycv8c/19:iso)MetaboCard
ECMDB24529PGP(19:1(9Z)/16:0)MetaboCard
ECMDB24530PGP(19:1(9Z)/16:1(9Z))MetaboCard
ECMDB24532PGP(19:iso/10:0(3-OH))MetaboCard
ECMDB24533PGP(19:iso/10:0)MetaboCard
ECMDB24534PGP(19:iso/12:0(3-OH))MetaboCard
ECMDB24535PGP(19:iso/12:0)MetaboCard
ECMDB24536PGP(19:iso/14:0(3-OH))MetaboCard
ECMDB24537PGP(19:iso/14:0)MetaboCard
ECMDB24538PGP(19:iso/15:0)MetaboCard
ECMDB24539PGP(19:iso/15:0cyclo)MetaboCard
ECMDB24541PGP(19:iso/16:1(9Z))MetaboCard
ECMDB24542PGP(19:iso/17:0cycw7c)MetaboCard
ECMDB24543PGP(19:iso/18:1(9Z))MetaboCard
ECMDB24544PGP(19:iso/19:0cycv8c)MetaboCard
ECMDB24410PGP(19:iso/19:iso)MetaboCard
ECMDB01429PhosphateMetaboCard
ECMDB21656PhosphatidylglycerophosphateMetaboCard
ECMDB24611PS(17:0cycw7c/14:0)MetaboCard
ECMDB00494WaterMetaboCard
GO Classification:
Function
catalytic activity
hydrolase activity
hydrolase activity, acting on ester bonds
phosphatase activity
phosphatidylglycerophosphatase activity
phosphoric ester hydrolase activity
Process
lipid metabolic process
metabolic process
primary metabolic process
Gene Properties
Blattner:b0418
Gene OrientationClockwise
Centisome Percentage:9.39
Left Sequence End435813
Right Sequence End436331
Gene Sequence:
>519 bp
ATGACCATTTTGCCACGCCATAAAGATGTCGCGAAAAGTCGCCTGAAGATGAGTAATCCG
TGGCATCTACTTGCTGTCGGATTCGGAAGTGGATTAAGCCCGATCGTTCCTGGGACGATG
GGCTCGCTGGCAGCGATTCCGTTCTGGTATCTGATGACCTTTTTGCCCTGGCAGCTCTAC
TCGCTGGTGGTGATGCTGGGGATCTGTATCGGCGTCTATCTTTGTCATCAAACGGCGAAA
GACATGGGTGTGCACGATCATGGCAGCATTGTCTGGGACGAATTTATTGGTATGTGGATC
ACGCTCATGGCGCTGCCGACCAATGACTGGCAGTGGGTTGCCGCCGGGTTTGTGATTTTC
CGTATTCTGGATATGTGGAAGCCGTGGCCGATCCGCTGGTTTGATCGCAATGTGCATGGC
GGCATGGGGATCATGATCGACGATATTGTCGCCGGGGTGATTTCCGCAGGCATCCTGTAT
TTTATCGGTCATCACTGGCCGCTGGGTATTCTGTCGTAG
Protein Properties
Pfam Domain Function:
Protein Residues:172
Protein Molecular Weight:19418
Protein Theoretical pI:8
Signaling Regions:
  • None
Transmembrane Regions:
  • 32-52
  • 54-74
  • 142-162
Protein Sequence:
>Phosphatidylglycerophosphatase A
MTILPRHKDVAKSRLKMSNPWHLLAVGFGSGLSPIVPGTMGSLAAIPFWYLMTFLPWQLY
SLVVMLGICIGVYLCHQTAKDMGVHDHGSIVWDEFIGMWITLMALPTNDWQWVAAGFVIF
RILDMWKPWPIRWFDRNVHGGMGIMIDDIVAGVISAGILYFIGHHWPLGILS
References
External Links:
ResourceLink
Uniprot ID:P18200
Uniprot Name:PGPA_ECOLI
GenBank Gene ID:AP009048
Genebank Protein ID:85674558
Ecogene ID:EG10704
Ecocyc:EG10704
ColiBase:b0418
Kegg Gene:b0418
EchoBASE ID:EB0698
CCDB:PGPA_ECOLI
BacMap:16128403
General Reference:
  • Blattner, F. R., Plunkett, G. 3rd, Bloch, C. A., Perna, N. T., Burland, V., Riley, M., Collado-Vides, J., Glasner, J. D., Rode, C. K., Mayhew, G. F., Gregor, J., Davis, N. W., Kirkpatrick, H. A., Goeden, M. A., Rose, D. J., Mau, B., Shao, Y. (1997). "The complete genome sequence of Escherichia coli K-12." Science 277:1453-1462. Pubmed: 9278503
  • Daley, D. O., Rapp, M., Granseth, E., Melen, K., Drew, D., von Heijne, G. (2005). "Global topology analysis of the Escherichia coli inner membrane proteome." Science 308:1321-1323. Pubmed: 15919996
  • Hayashi, K., Morooka, N., Yamamoto, Y., Fujita, K., Isono, K., Choi, S., Ohtsubo, E., Baba, T., Wanner, B. L., Mori, H., Horiuchi, T. (2006). "Highly accurate genome sequences of Escherichia coli K-12 strains MG1655 and W3110." Mol Syst Biol 2:2006.0007. Pubmed: 16738553
  • Icho, T. (1988). "Membrane-bound phosphatases in Escherichia coli: sequence of the pgpA gene." J Bacteriol 170:5110-5116. Pubmed: 2846510