Identification
Name:Cysteine synthase B
Synonyms:
  • CSase B
  • O-acetylserine (thiol)-lyase B
  • OAS-TL B
  • O-acetylserine sulfhydrylase B
Gene Name:cysM
Enzyme Class:
Biological Properties
General Function:Involved in cysteine biosynthetic process from serine
Specific Function:Two cysteine synthase enzymes are found. Both catalyze the same reaction. Cysteine synthase B can also use thiosulfate in place of sulfide to give cysteine thiosulfonate as a product
Cellular Location:Not Available
SMPDB Pathways:
KEGG Pathways:
KEGG Reactions:
Thumb+ThumbThumb+Thumb+Thumb
Thumb+ThumbThumb+Thumb
Thumb+ThumbThumb+Thumb
Thumb+ThumbThumb+Thumb
Thumb+Thumb+Thioredoxin+ThumbThumb+Thumb+Thioredoxin disulfide+Thumb
O-Acetylserine + Thiosulfate + Thioredoxin + Hydrogen ionL-Cysteine + Sulfite + Thioredoxin disulfide + Acetic acid
ReactionCard
SMPDB Reactions:
ThumbThumb+Thumb+Thumb
Thumb+ThumbThumb+Thumb+Thumb
Thumb+ThumbThumb+Thumb+Thumb
ThumbThumb+Thumb+Thumb
Thumb+Thiosulfate+ThumbThumb+Thumb
EcoCyc Reactions:
Thumb+ThumbThumb+Thumb+Thumb
Complex Reactions:
Thumb+ThumbThumb+Thumb
Metabolites:
ECMDB IDNameView
ECMDB036092-Aminoacrylic acidMetaboCard
ECMDB00042Acetic acidMetaboCard
ECMDB00731Cysteine-S-sulfateMetaboCard
ECMDB21225Hydrogen ionMetaboCard
ECMDB11110Hydrogen selenideMetaboCard
ECMDB03276Hydrogen sulfideMetaboCard
ECMDB00574L-CysteineMetaboCard
ECMDB03011O-AcetylserineMetaboCard
ECMDB03288SelenocysteineMetaboCard
ECMDB00240SulfiteMetaboCard
ECMDB23749ThioredoxinMetaboCard
ECMDB00257ThiosulfateMetaboCard
GO Classification:
Function
binding
carbon-oxygen lyase activity
catalytic activity
cofactor binding
cysteine synthase activity
lyase activity
pyridoxal phosphate binding
Process
cellular amino acid and derivative metabolic process
cellular amino acid metabolic process
cellular metabolic process
cysteine biosynthetic process from serine
L-serine metabolic process
metabolic process
serine family amino acid metabolic process
Gene Properties
Blattner:b2421
Gene OrientationCounterclockwise
Centisome Percentage:54.67
Left Sequence End2536694
Right Sequence End2537605
Gene Sequence:
>912 bp
ATGCGACTATTTAACTGGCGACGTCAGGCGGTGTTAAACGCCATGCCACTGGTCAAACCT
GACCAGGTACGTACACCGTGGCATGAATTCTGGCGACGATTTCGCCGTCAGCATATGGCG
ATGACCGCCGCATTATTCGTTATTTTATTGATTGTGGTGGCCATTTTTGCACGCTGGATC
GCTCCCTATGACGCCGAAAATTATTTTGATTATGACAATCTGAATAACGGACCTTCTTTG
CAGCACTGGTTTGGCGTCGATTCACTGGGGCGTGACATTTTCAGCCGTGTCCTGGTTGGT
GCGCAAATCTCGCTGGCGGCGGGCGTGTTTGCCGTGTTTATCGGTGCGGCGATCGGGACG
TTGCTGGGCTTGCTCGCTGGATATTATGAAGGCTGGTGGGATCGGCTGATCATGCGCATT
TGCGATGTGCTGTTTGCCTTCCCGGGTATTTTACTGGCGATCGCTGTTGTTGCGGTGTTG
GGAAGCGGCATTGCTAACGTGATTATTGCAGTCGCCATTTTTTCCATCCCCGCGTTTGCC
CGCCTGGTGCGCGGCAACACGCTGGTGTTGAAACAGCAAACCTTTATTGAGTCAGCACGC
AGTATTGGTGCCAGCGATATGACCGTTTTGTTGCGTCATATCCTGCCTGGGACCGTCTCT
TCTATCGTGGTGTTTTTCACCATGCGCATTGGTACCTCGATTATCTCTGCCGCCAGCCTC
TCATTTCTCGGCCTCGGTGCGCAGCCGCCGACACCAGAGTGGGGAGCAATGCTCAATGAG
GCTCGAGCGGATATGGTTATCGCGCCGCATGTCGCTGTTTTTCCGGCCCTGGCTATTTTT
CTGACCGTACTGGCGTTCAATTTGTTGGGCGATGGTTTACGCGATGCGCTGGATCCGAAA
ATTAAAGGATAG
Protein Properties
Pfam Domain Function:
Protein Residues:303
Protein Molecular Weight:32664
Protein Theoretical pI:5
Signaling Regions:
  • None
Transmembrane Regions:
  • None
Protein Sequence:
>Cysteine synthase B
MSTLEQTIGNTPLVKLQRMGPDNGSEVWLKLEGNNPAGSVKDRAALSMIVEAEKRGEIKP
GDVLIEATSGNTGIALAMIAALKGYRMKLLMPDNMSQERRAAMRAYGAELILVTKEQGME
GARDLALEMANRGEGKLLDQFNNPDNPYAHYTTTGPEIWQQTGGRITHFVSSMGTTGTIT
GVSRFMREQSKPVTIVGLQPEEGSSIPGIRRWPTEYLPGIFNASLVDEVLDIHQRDAENT
MRELAVREGIFCGVSSGGAVAGALRVAKANPDAVVVAIICDRGDRYLSTGVFGEEHFSQG
AGI
References
External Links:
ResourceLink
Uniprot ID:P16703
Uniprot Name:CYSM_ECOLI
GenBank Gene ID:AP009048
Genebank Protein ID:4062409
Ecogene ID:EG10193
Ecocyc:EG10193
ColiBase:b2421
Kegg Gene:b2421
EchoBASE ID:EB0190
CCDB:CYSM_ECOLI
BacMap:16130347
General Reference:
  • Blattner, F. R., Plunkett, G. 3rd, Bloch, C. A., Perna, N. T., Burland, V., Riley, M., Collado-Vides, J., Glasner, J. D., Rode, C. K., Mayhew, G. F., Gregor, J., Davis, N. W., Kirkpatrick, H. A., Goeden, M. A., Rose, D. J., Mau, B., Shao, Y. (1997). "The complete genome sequence of Escherichia coli K-12." Science 277:1453-1462. Pubmed: 9278503
  • Claus, M. T., Zocher, G. E., Maier, T. H., Schulz, G. E. (2005). "Structure of the O-acetylserine sulfhydrylase isoenzyme CysM from Escherichia coli." Biochemistry 44:8620-8626. Pubmed: 15952768
  • Hayashi, K., Morooka, N., Yamamoto, Y., Fujita, K., Isono, K., Choi, S., Ohtsubo, E., Baba, T., Wanner, B. L., Mori, H., Horiuchi, T. (2006). "Highly accurate genome sequences of Escherichia coli K-12 strains MG1655 and W3110." Mol Syst Biol 2:2006.0007. Pubmed: 16738553
  • Sirko, A., Hryniewicz, M., Hulanicka, D., Bock, A. (1990). "Sulfate and thiosulfate transport in Escherichia coli K-12: nucleotide sequence and expression of the cysTWAM gene cluster." J Bacteriol 172:3351-3357. Pubmed: 2188958
  • Yamamoto, Y., Aiba, H., Baba, T., Hayashi, K., Inada, T., Isono, K., Itoh, T., Kimura, S., Kitagawa, M., Makino, K., Miki, T., Mitsuhashi, N., Mizobuchi, K., Mori, H., Nakade, S., Nakamura, Y., Nashimoto, H., Oshima, T., Oyama, S., Saito, N., Sampei, G., Satoh, Y., Sivasundaram, S., Tagami, H., Horiuchi, T., et, a. l. .. (1997). "Construction of a contiguous 874-kb sequence of the Escherichia coli -K12 genome corresponding to 50.0-68.8 min on the linkage map and analysis of its sequence features." DNA Res 4:91-113. Pubmed: 9205837