Identification
Name:Alpha-D-ribose 1-methylphosphonate 5-triphosphate synthase subunit PhnI
Synonyms:Not Available
Gene Name:phnI
Enzyme Class:
Biological Properties
General Function:organic phosphonate catabolic process
Specific Function:Together with PhnG, PhnH and PhnL is required for the transfer of the ribose triphosphate moiety from ATP to methyl phosphonate. PhnI alone has nucleosidase activity, catalyzing the hydrolysis of ATP or GTP forming alpha-D-ribose 5-triphosphate and adenine or guanine, respectively.
Cellular Location:Not Available
SMPDB Pathways:
KEGG Pathways:
  • Phosphonate and phosphinate metabolism ec00440
KEGG Reactions:
Thumb+ThumbThumb+Thumb
SMPDB Reactions:
Thumb+ThumbThumb+Thumb
Metabolites:
ECMDB IDNameView
ECMDB00034AdenineMetaboCard
ECMDB00538Adenosine triphosphateMetaboCard
ECMDB23845alpha-D-Ribose 1-methylphosphonate 5-triphosphateMetaboCard
ECMDB20326MethylphosphonateMetaboCard
GO Classification:
Function
organic phosphonate catabolic process
transferase activity
Gene Properties
Blattner:Not Available
Gene OrientationNot Available
Centisome Percentage:Not Available
Left Sequence EndNot Available
Right Sequence EndNot Available
Gene Sequence:
>1065
atgtacgttgccgtgaaagggggcgagaaggcgatcgacgccgcccacgccctgcaagag
agccgacgccgaggcgataccgatttgcccgaactgagcgtcgcccagattgaacagcag
cttaacctcgcggtagatcgcgtgatgaccgaaggcggcattgccgaccgcgaactggcg
gcgctggcgctgaaacaggccagcggcgataacgttgaagcgattttcctgctgcgcgcc
taccgcaccacgttggcgaagctggcggtaagcgagccgctcgacaccaccgggatgcgt
ctcgaacgccgtatctccgccgtttataaagacattcccggcggccagctgcttggccca
acctacgactacacccatcgcctgctcgattttaccctgctggcaaacggcgaagcgccg
acgctgaccaccgccgacagcgaacagcagccgtcgccgcacgttttcagcctgctggcg
cgtcaggggctggcgaagtttgaagaggatagcggcgcacagccggatgacatcacccgc
acgccgccggtttacccctgctcacgctcctcccgtttgcagcagttgatgcgcggcgac
gaaggctatttgctggcgctggcctactccacccaacgcggttacgggcgcaatcacccg
ttcgcaggcgagatccgcagcggctatatcgacgtgtcgattgtgccggaagagctggga
tttgcggtgaacgtcggcgaactgctgatgactgagtgtgaaatggttaacggttttatc
gacccgccgggtgagccgccgcacttcacgcgcggctacgggctggtgttcggcatgagc
gagcgcaaagcgatggcgatggcgctggtcgaccgcgctctgcaagccccggagtacggc
gagcacgcgacaggcccggcgcaggatgaagagttcgtgctggcacatgccgacaacgtc
gaagccgcaggctttgtctcacacctcaaactcccccactacgtcgatttccaggccgaa
ctggagctactcaaacgtctgcaacaggagcagaaccatggctaa
Protein Properties
Pfam Domain Function:Not Available
Protein Residues:354
Protein Molecular Weight:38852
Protein Theoretical pI:Not Available
Signaling Regions:Not Available
Transmembrane Regions:Not Available
Protein Sequence:
>Alpha-D-ribose 1-methylphosphonate 5-triphosphate synthase subunit PhnI
MYVAVKGGEKAIDAAHALQESRRRGDTDLPELSVAQIEQQLNLAVDRVMTEGGIADRELA
ALALKQASGDNVEAIFLLRAYRTTLAKLAVSEPLDTTGMRLERRISAVYKDIPGGQLLGP
TYDYTHRLLDFTLLANGEAPTLTTADSEQQPSPHVFSLLARQGLAKFEEDSGAQPDDITR
TPPVYPCSRSSRLQQLMRGDEGYLLALAYSTQRGYGRNHPFAGEIRSGYIDVSIVPEELG
FAVNVGELLMTECEMVNGFIDPPGEPPHFTRGYGLVFGMSERKAMAMALVDRALQAPEYG
EHATGPAQDEEFVLAHADNVEAAGFVSHLKLPHYVDFQAELELLKRLQQEQNHG
References
External Links:
ResourceLink
Uniprot ID:P16687
Uniprot Name:PHNI_ECOLI
CCDB:PHNI_ECOLI
General Reference:Not Available