Identification
Name:Alpha-D-ribose 1-methylphosphonate 5-triphosphate synthase subunit PhnG
Synonyms:Not Available
Gene Name:phnG
Enzyme Class:
Biological Properties
General Function:organic phosphonate transport
Specific Function:Together with PhnH, PhnI and PhnL is required for the transfer of the ribose triphosphate moiety from ATP to methyl phosphonate.
Cellular Location:Not Available
SMPDB Pathways:
KEGG Pathways:
  • Phosphonate and phosphinate metabolism ec00440
KEGG Reactions:
Thumb+ThumbThumb+Thumb
SMPDB Reactions:
Thumb+ThumbThumb+Thumb
Metabolites:
ECMDB IDNameView
ECMDB00034AdenineMetaboCard
ECMDB00538Adenosine triphosphateMetaboCard
ECMDB23845alpha-D-Ribose 1-methylphosphonate 5-triphosphateMetaboCard
ECMDB20326MethylphosphonateMetaboCard
GO Classification:
Function
organic phosphonate catabolic process
organic phosphonate transport
transferase activity
Gene Properties
Blattner:Not Available
Gene OrientationNot Available
Centisome Percentage:Not Available
Left Sequence EndNot Available
Right Sequence EndNot Available
Gene Sequence:
>453
atgcacgcagataccgcgacccgccagcactggatgtccgtgctggcgcacagccaaccg
gctgaactggcagcacgcctgaacgcgctaaacatcaccgccgactatgaggtgatccgc
gccgctgaaactggcctggtacagattcaggcgcggatgggcggcaccggcgaacgtttt
tttgccggcgacgccacgctgacccgcgccgccgtgcgcctgactgacggcacgctcggc
tacagctgggtgcaggggcgtgataaacagcacgccgaacgctgcgcgctgattgacgcg
ctgatgcagcaatctcgccactttcaaaacttatcagaaacccttattgccccgctggac
gctgaccgtatggcacgcattgccgcacgccaggccgaagtgaacgccagccgggtcgac
ttctttacgatggttcgcggagacaacgcatga
Protein Properties
Pfam Domain Function:Not Available
Protein Residues:150
Protein Molecular Weight:16539
Protein Theoretical pI:Not Available
Signaling Regions:Not Available
Transmembrane Regions:Not Available
Protein Sequence:
>Alpha-D-ribose 1-methylphosphonate 5-triphosphate synthase subunit PhnG
MHADTATRQHWMSVLAHSQPAELAARLNALNITADYEVIRAAETGLVQIQARMGGTGERF
FAGDATLTRAAVRLTDGTLGYSWVQGRDKQHAERCALIDALMQQSRHFQNLSETLIAPLD
ADRMARIAARQAEVNASRVDFFTMVRGDNA
References
External Links:
ResourceLink
Uniprot ID:P16685
Uniprot Name:PHNG_ECOLI
CCDB:PHNG_ECOLI
General Reference:Not Available